Recombinant Nicotiana tabacum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

The psbB gene encodes the CP47 protein, a 47 kDa chlorophyll a-binding subunit integral to the PSII reaction center. CP47 stabilizes the chlorophyll molecules and facilitates electron transfer from the oxygen-evolving complex to the reaction center . In N. tabacum, PSII biogenesis involves coordinated assembly of subunits, including CP47, which is synthesized in the chloroplast and integrated into thylakoid membranes .

Transplastomic Engineering

A key approach involves replacing the native psbB gene in the chloroplast genome with an engineered version. For example, inserting a C-terminal His-tag into the psbB gene enables affinity purification of functional PSII complexes. This method was demonstrated in transplastomic tobacco plants, where the His-tagged CP47 protein associated with other PSII subunits, facilitating isolation of the core complex .

MethodKey FeaturesLimitations
Chloroplast transformationStable expression; avoids nuclear genome integrationHeteroplasmy issues require multiple rounds of antibiotic selection
Nuclear expressionAllotopic expression with transit peptides; rescue of mutants (e.g., ΔpsbN)Lower efficiency due to competition with endogenous chloroplast proteins

Challenges in Expression

  • Genetic Instability: Transposon transfer from Agrobacterium tumefaciens Ti plasmids (e.g., pAL4404) into the T-DNA cassette can disrupt expression when using the 35S promoter, particularly with toxic proteins .

  • N-Glycosylation: N. tabacum introduces plant-specific modifications (e.g., β(1,2)-xylose, α(1,3)-fucose) that may alter protein immunogenicity. CRISPR/Cas9-mediated knockout of glycosyltransferases (XylT, FucT) in N. tabacum cv. SR-1 enables human-like glycosylation, enhancing biopharmaceutical compatibility .

Biotechnological Applications

  • PSII Purification: His-tagged psbB allows large-scale isolation of functional PSII complexes for industrial applications .

  • Protein Engineering: CRISPR-edited N. tabacum lines with humanized glycosylation enhance recombinant protein quality for medical use .

Production Limitations

  • Low Yield: Transplastomic plants yield limited PSII core complexes due to inefficient extraction .

  • Transposon Interference: Mitigation strategies include using non-toxic promoters or alternative Agrobacterium strains .

Emerging Strategies

  • Glycoengineering: Knockout of XylT and FucT in N. tabacum enables production of recombinant antibodies and vaccines with reduced immunogenicity .

  • Allotopic Expression: Nuclear expression of psbB fused to chloroplast transit peptides rescues PSII-deficient mutants, suggesting potential for synthetic biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function
A core component of the Photosystem II (PSII) complex, this chlorophyll-binding protein catalyzes PSII's primary light-induced photochemical reactions. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, producing O₂ and a proton gradient for subsequent ATP synthesis.
Database Links

KEGG: nta:800527

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of CP47 in Nicotiana tabacum?

CP47 in Nicotiana tabacum is a membrane protein with six transmembrane domains (TMDs) that form three extrinsic loop regions on the lumen side of the thylakoid membrane. Among these loops, the largest one (E loop) is positioned between the fifth and sixth TMD and contains approximately 200 amino acids, making it a distinctive structural feature of this protein . This E loop plays a crucial role in the protein's function as it interacts with several important PSII components including the luminal extrinsic proteins PsbP, PsbO, and PsbTn, as well as with the luminal loop of the D2 protein . Two small membrane-intrinsic subunits, PsbH and PsbL, associate directly with CP47 and further interact with D2, creating a network of protein-protein interactions that stabilize the PSII complex . The protein has an expected molecular weight of approximately 56 kDa as determined by electrophoretic mobility studies, which aligns with predictions based on its amino acid sequence . This structural organization is highly conserved across plant species, making Nicotiana tabacum CP47 a representative model for understanding PSII structure and function in higher plants.

What is the functional role of CP47 in Photosystem II?

CP47 serves as a proximal antenna protein in Photosystem II, playing a critical role in light harvesting and energy transfer to the reaction center. This chlorophyll-binding protein facilitates the capture of light energy and its efficient transfer to the PSII reaction center, where charge separation occurs during photosynthesis . Beyond its light-harvesting function, CP47 plays a structural role in the assembly and stability of the PSII complex, as evidenced by studies showing that during the assembly process of PSII, the pre-CP47 subcomplex containing CP47 and several small membrane intrinsic subunits associates with the PSII reaction center (RC) to form the CP43-less PSII complex . Mutations affecting CP47 synthesis or assembly significantly impair PSII function, demonstrating its essential nature for photosynthetic activity . In the fpb1 mutant, where CP47 synthesis is reduced to approximately 50% compared to wild type, PSII subunits are predominantly found in the PSII monomer and CP43-less PSII complex rather than in the fully assembled complex, indicating inefficient PSII assembly . The E loop of CP47 forms important interactions with other PSII subunits, contributing to the structural integrity and function of the entire complex.

How does CP47 interact with other components of the Photosystem II complex?

CP47 engages in multiple protein-protein interactions that are essential for the structure and function of the PSII complex. The E loop of CP47, which extends into the thylakoid lumen, directly interacts with several extrinsic proteins including PsbO (the manganese-stabilizing protein), PsbP, and PsbTn, forming connections that stabilize the oxygen-evolving complex . These interactions are critical for maintaining optimal water-splitting activity at the manganese cluster. On the membrane-embedded portion, CP47 associates closely with two small membrane-intrinsic subunits, PsbH and PsbL, which in turn interact with the D2 protein of the reaction center . This creates a network of interactions that positions CP47 properly within the PSII complex and ensures efficient energy transfer from the antenna system to the reaction center. During the assembly process, CP47 first forms a pre-CP47 subcomplex with several small membrane proteins before associating with the PSII reaction center to form intermediate complexes . In the fpb1 mutant, where CP47 synthesis is reduced, the pre-CP47 complex is almost undetectable, whereas the PSII reaction center accumulates to relatively higher levels, indicating a bottleneck in the assembly process . These interaction patterns highlight the central role of CP47 in both the structure and assembly pathway of PSII.

What are the most effective systems for recombinant expression of tobacco CP47?

Expression of recombinant CP47 from tobacco presents significant challenges due to its complex membrane protein nature with multiple transmembrane domains. Based on current research, chloroplast transformation systems provide the most effective approach for expressing functional CP47, as they offer the native membrane environment and processing machinery required for proper folding and assembly . When using chloroplast-based expression systems, it's critical to maintain the genomic context of the psbB gene, as its expression is coordinated with other photosynthetic genes in the chloroplast genome. Heterologous expression in cyanobacterial systems like Synechocystis PCC 6803 represents an alternative approach, taking advantage of the conserved nature of photosynthetic machinery across photosynthetic organisms . These systems provide the thylakoid membrane environment and assembly factors necessary for CP47 integration. Expression in conventional systems such as E. coli typically yields non-functional protein due to the absence of chloroplast-specific chaperones and assembly factors like FPB1 and PAM68, which have been shown to facilitate the integration of CP47 into thylakoid membranes during translation . Cell-free systems supplemented with thylakoid membranes and chloroplast chaperones offer a promising alternative for in vitro studies but generally yield limited amounts of properly folded protein.

What purification strategies yield the highest purity of recombinant CP47 while maintaining protein integrity?

Purification of recombinant CP47 requires specialized techniques that maintain the integrity of this membrane protein throughout the isolation process. Initial solubilization of thylakoid membranes should employ mild detergents such as n-dodecyl-β-D-maltoside (β-DDM) or digitonin, which effectively extract membrane proteins while preserving their native conformation and associated lipids . Following solubilization, a combination of ion exchange chromatography and size exclusion chromatography provides effective separation of CP47 from other membrane proteins. For antibody-based purification approaches, commercially available antibodies against the conserved regions of CP47, such as those documented in search result 5, can be utilized for immunoprecipitation or immunoaffinity chromatography . The purification process should be conducted at 4°C with the inclusion of protease inhibitors to prevent degradation of the protein. The purity and integrity of isolated CP47 can be assessed using a combination of SDS-PAGE, Western blotting with specific antibodies, and spectroscopic analysis to confirm the presence of bound chlorophyll molecules . For structural and functional studies, additional purification steps using sucrose gradient ultracentrifugation may be necessary to isolate intact CP47-containing subcomplexes. Throughout the purification process, it's essential to maintain the protein in a detergent-lipid environment that mimics the native membrane to preserve its structural integrity.

What are the critical factors affecting the yield and stability of recombinant CP47 during expression?

Multiple factors significantly impact the yield and stability of recombinant CP47 during expression, with translation efficiency being particularly critical. Research has shown that ribosome elongation pauses when the last transmembrane domain of CP47 emerges from the ribosomal tunnel during psbB translation, indicating a bottleneck in the synthesis process that requires auxiliary factors . The presence of assembly factors like FPB1 and PAM68 is essential, as these proteins interact with CP47, the Alb3 integrase, and components of the SecY/E system to facilitate proper membrane integration . Light conditions during expression significantly affect CP47 stability, as excessive light can lead to photoinhibition and subsequent degradation of PSII components including CP47; this effect is particularly pronounced in mutants deficient in repair mechanisms, such as the psbN mutant, which fails to recover from photoinhibition . The stoichiometric balance of other PSII components during expression also affects CP47 stability, as the protein may be degraded if it cannot be properly incorporated into PSII subcomplexes . Temperature control during expression is crucial, with lower temperatures (16-22°C) generally favoring proper folding of membrane proteins by slowing the translation rate. The composition of the growth medium, particularly regarding metal ions and cofactors necessary for chlorophyll biosynthesis, directly impacts the formation of functional CP47, which binds multiple chlorophyll molecules essential for its light-harvesting function.

How can researchers effectively detect and quantify CP47 in experimental samples?

Detection and quantification of CP47 in experimental samples can be accomplished through several complementary approaches. Immunological techniques using specific antibodies against CP47 offer high sensitivity and specificity, with Western blotting being particularly effective for detecting the protein in complex mixtures . Available commercial antibodies, such as those described in search result 5, typically recognize conserved epitopes of CP47 across multiple plant species including Nicotiana tabacum, and can be used at dilutions of 1:2000 for Western blot applications . For native complex analysis, Clear-Native PAGE (CN-PAGE) followed by immunoblotting with anti-CP47 antibodies at a dilution of 1:10,000 allows visualization of CP47 within its native protein complexes and subcomplexes . Spectroscopic methods provide another approach for quantifying functional CP47, as the protein binds multiple chlorophyll molecules with characteristic absorption and fluorescence properties that can be measured to estimate protein concentration and functionality. Mass spectrometry-based proteomics offers the most precise quantification, with targeted approaches such as multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) allowing absolute quantification of CP47 peptides in complex samples. For in vivo studies, pulse-labeling experiments with radioactive amino acids can track the synthesis rates of CP47, as demonstrated in studies showing reduced synthesis (approximately 50%) in the fpb1 mutant compared to wild type .

What methods are most effective for studying CP47-protein interactions in PSII?

Investigation of CP47-protein interactions within PSII requires specialized techniques that preserve native protein complexes and capture both stable and transient interactions. Blue-native PAGE (BN-PAGE) and clear-native PAGE (CN-PAGE) followed by second-dimension SDS-PAGE (2D BN/SDS-PAGE) represent powerful approaches for visualizing CP47 within different PSII assembly intermediates and supercomplexes . This technique has successfully revealed the accumulation patterns of CP47 in various subcomplexes, such as the pre-CP47 complex, CP43-less PSII complex, and PSII monomer in wild-type plants versus assembly factor mutants like fpb1 . Co-immunoprecipitation using anti-CP47 antibodies followed by mass spectrometry analysis can identify proteins that directly interact with CP47, including both core PSII subunits and assembly factors. Chemical cross-linking coupled with mass spectrometry (CX-MS) provides detailed information about the spatial relationships between CP47 and its interaction partners, identifying specific amino acid residues involved in these interactions. For studying dynamic assembly processes, pulse-chase experiments combined with BN-PAGE separation can track the incorporation of newly synthesized CP47 into various assembly intermediates over time. Split-ubiquitin yeast two-hybrid systems adapted for membrane proteins offer another approach for testing specific protein-protein interactions involving CP47, though these require careful design of constructs to accommodate the multiple transmembrane domains of CP47.

What are the best approaches for analyzing the assembly process of CP47 into PSII complexes?

Analyzing the assembly of CP47 into PSII complexes requires methodologies that can capture the dynamic nature of this process while providing resolution of various assembly intermediates. Pulse-chase labeling combined with BN-PAGE or CN-PAGE represents a powerful approach for tracking the incorporation of newly synthesized CP47 into progressively larger assemblies over time . This technique has been instrumental in revealing assembly defects in mutants like fpb1, where CP47 fails to efficiently form the pre-CP47 complex and subsequent higher-order assemblies . Time-resolved proteomics using stable isotope labeling can provide a more comprehensive view of the assembly kinetics, identifying the order and timing of association between CP47 and other PSII components. Ribosome profiling techniques have proven valuable for studying co-translational membrane integration of CP47, revealing ribosome pausing sites during translation that correspond to critical points in the insertion process where assembly factors like FPB1 and PAM68 may act . Genetic approaches using inducible promoters to control CP47 expression, combined with time-course sampling and complex analysis, can synchronize the assembly process for more detailed examination. Cryo-electron microscopy of samples collected at different time points during assembly can provide structural snapshots of assembly intermediates, though this approach is technically challenging due to the heterogeneity of samples. Comparative analysis between wild-type plants and mutants defective in specific assembly factors, such as fpb1, pam68, or psbN, has proven particularly insightful for understanding the roles of these factors in facilitating CP47 assembly .

What are the consequences of specific mutations in the psbB gene on PSII function?

Mutations in the psbB gene lead to a spectrum of effects on PSII function, depending on the nature and location of the mutation within the protein structure. Mutations affecting the transmembrane domains typically disrupt the proper folding and integration of CP47 into the thylakoid membrane, resulting in severe impairment of PSII assembly and function . Alterations to the E loop region between the fifth and sixth transmembrane domains compromise interactions with extrinsic proteins like PsbO, PsbP, and PsbTn, destabilizing the oxygen-evolving complex and reducing water-splitting activity . Point mutations affecting chlorophyll-binding residues alter the spectroscopic properties of CP47 and reduce energy transfer efficiency to the reaction center, manifesting as decreased quantum yield of photosynthesis. Mutations that affect the interaction sites with small membrane-intrinsic subunits like PsbH and PsbL destabilize the association of CP47 with the PSII reaction center, resulting in increased accumulation of assembly intermediates like the CP43-less PSII complex . Complete knockout or severe truncation mutations of psbB prevent PSII assembly beyond the reaction center stage, as observed in various assembly factor mutants where CP47 synthesis or integration is compromised . These mutant phenotypes highlight the essential role of CP47 not only as a light-harvesting antenna but also as a structural component necessary for the assembly and stability of the PSII complex.

How do assembly factor mutations affect CP47 synthesis and integration into PSII?

Assembly factor mutations reveal critical insights into the process of CP47 synthesis and integration into the PSII complex. In the fpb1 mutant, ribosome elongation pauses when the last transmembrane domain of CP47 emerges from the ribosomal tunnel during psbB translation, resulting in approximately 50% reduction in CP47 synthesis compared to wild type . This indicates that FPB1 plays a role in facilitating the translation elongation or membrane integration of specific regions of CP47. Similarly, the pam68 mutant exhibits comparable ribosome stalling patterns during CP47 synthesis, suggesting that PAM68 cooperates with FPB1 in this process . Both FPB1 and PAM68 interact with the Alb3 integrase and components of the SecY/E system, indicating their involvement in coordinating the membrane integration machinery during CP47 synthesis . In these assembly factor mutants, the majority of the synthesized CP47 is found in the PSII monomer and CP43-less PSII complex, with almost undetectable levels in the pre-CP47 complex position, suggesting inefficient early-stage assembly . The psbN mutant, while not directly affecting CP47 synthesis, shows deficiencies in the assembly of the heterodimeric PSII reaction center and impaired repair from photoinhibition, indicating that PsbN facilitates a step in PSII assembly that indirectly affects CP47 incorporation into functional complexes . These mutations collectively demonstrate the requirement for multiple auxiliary factors in the coordinated synthesis, membrane integration, and assembly of CP47 into PSII.

What techniques are most informative for analyzing CP47 mutant phenotypes?

A multi-faceted analytical approach yields the most comprehensive understanding of CP47 mutant phenotypes. Chlorophyll fluorescence analysis provides rapid, non-invasive assessment of PSII function in CP47 mutants, with parameters like Fv/Fm (maximum quantum yield), NPQ (non-photochemical quenching), and electron transport rate offering insights into specific aspects of photosynthetic performance . This technique can also track recovery from photoinhibition, which is severely impaired in mutants affecting the PSII repair cycle, such as the psbN mutant . Biochemical analysis using 2D BN/SDS-PAGE followed by immunoblotting allows visualization of CP47 distribution among various PSII subcomplexes and assembly intermediates, revealing specific assembly defects in mutants like fpb1 where CP47 fails to efficiently form the pre-CP47 complex . Pulse-labeling experiments with radioactive amino acids can quantify the synthesis rates of CP47 and other photosynthetic proteins, as demonstrated in studies showing reduced synthesis in the fpb1 mutant . Ribosome profiling provides mechanistic insights by identifying ribosome pausing sites during CP47 translation, which has been observed when the last transmembrane domain emerges from the ribosomal tunnel in assembly factor mutants . Protein interaction studies using co-immunoprecipitation or split-ubiquitin assays can determine how mutations affect CP47's ability to interact with other PSII subunits or assembly factors. Structural analysis using techniques like cryo-electron microscopy, though challenging with mutant samples, can reveal how specific mutations alter the conformation of CP47 and its integration into the PSII complex.

How can recombinant CP47 be utilized for structural studies of PSII?

Recombinant CP47 offers valuable opportunities for advancing structural studies of PSII through several sophisticated approaches. Site-directed mutagenesis of recombinant CP47 enables systematic structure-function analysis by introducing specific amino acid substitutions at putative chlorophyll-binding sites, interaction interfaces, or functionally important regions, with subsequent structural characterization revealing how these modifications affect protein folding, complex assembly, and function . Generation of CP47 variants with incorporated non-canonical amino acids at specific positions allows for selective chemical modifications, such as the attachment of spectroscopic probes or cross-linking agents, providing tools for investigating local protein environment or capturing transient interactions during assembly . Expression of truncated or chimeric CP47 constructs helps delineate the structural determinants for membrane integration, protein-protein interactions, and chlorophyll binding, particularly focusing on the critical E loop region between the fifth and sixth transmembrane domains . For cryo-electron microscopy studies, recombinant expression systems can be optimized to produce sufficient quantities of CP47-containing subcomplexes with improved homogeneity, enhancing the resolution of structural models. Co-expression of CP47 with specific interaction partners in controlled stoichiometric ratios facilitates the isolation of defined subcomplexes for structural analysis, bypassing some of the heterogeneity issues encountered with complexes isolated from natural membranes. These approaches collectively contribute to a more detailed understanding of how CP47 integrates into the PSII complex and participates in the structural framework supporting photosynthetic water oxidation.

What are the current challenges in studying CP47 folding and membrane integration?

Investigating CP47 folding and membrane integration presents several significant challenges that require innovative methodological approaches. The co-translational nature of CP47 membrane integration complicates in vitro studies, as the process involves coordinated action of the ribosome, membrane insertase machinery (like SecY/E and Alb3), and specific assembly factors (FPB1 and PAM68) that are difficult to reconstitute outside the cellular context . Recent ribosome profiling data indicating pausing when the last transmembrane domain of CP47 emerges from the ribosomal tunnel highlights the complexity of the integration process and suggests the need for specialized factors at specific stages . The large size of CP47 (56 kDa) with its six transmembrane domains presents inherent challenges for structural studies, particularly for techniques like NMR spectroscopy that are otherwise powerful for studying membrane protein folding intermediates . The presence of bound chlorophylls in the native protein adds another layer of complexity, as proper folding likely occurs in concert with pigment attachment, a process that requires specific enzymatic machinery present in chloroplasts . The hydrophobic nature of the transmembrane domains leads to aggregation issues during in vitro studies unless appropriate membrane mimetics are employed. Time-resolved studies of the folding and assembly pathway are challenging due to the rapid nature of some steps and the difficulty in synchronizing the process across a population of molecules. Despite these challenges, emerging techniques such as single-molecule force spectroscopy, hydrogen-deuterium exchange mass spectrometry, and improved membrane mimetics are beginning to provide new insights into the folding and integration process of complex membrane proteins like CP47.

How do environmental factors influence CP47 synthesis and degradation in research settings?

Environmental conditions significantly impact CP47 synthesis and degradation dynamics, creating important considerations for experimental design in research settings. Light intensity represents one of the most critical factors, as high light conditions accelerate photoinhibition, leading to increased damage and turnover of PSII components including CP47 . This effect is particularly pronounced in mutants defective in assembly or repair mechanisms, such as the psbN mutant, which fails to recover from photoinhibition due to impaired assembly of the PSII reaction center . Temperature affects both synthesis and degradation rates, with elevated temperatures accelerating protein degradation while potentially impairing proper folding and assembly of newly synthesized CP47 . Oxidative stress, whether induced by high light, chemical treatment, or genetic manipulation of antioxidant systems, enhances degradation of CP47 through damage to its protein structure and associated chlorophylls. Nutrient availability, particularly iron, copper, and magnesium, influences both the synthesis of CP47 and its cofactors like chlorophyll, with deficiencies leading to reduced accumulation of functional protein . pH changes in the experimental medium can alter thylakoid lumen pH, affecting the conformation of the E loop of CP47 that extends into this compartment and potentially destabilizing its interactions with extrinsic proteins . These environmental factors must be carefully controlled in experimental settings to ensure reproducible results, especially when comparing wild-type and mutant phenotypes or evaluating the effects of specific treatments on CP47 synthesis, assembly, and degradation.

How does Nicotiana tabacum CP47 compare structurally and functionally to that of other model organisms?

Comparative analysis reveals that Nicotiana tabacum CP47 maintains high structural and functional conservation with homologs from diverse photosynthetic organisms, reflecting the fundamental importance of this protein in photosynthesis. The primary sequence of CP47 shows significant conservation across species, with particularly high homology in the transmembrane domains and chlorophyll-binding regions, as evidenced by the cross-reactivity of antibodies against CP47 across multiple plant species, algae, and cyanobacteria . The six-transmembrane domain architecture with the characteristic E loop between the fifth and sixth domains represents a universally conserved structural feature across all oxygenic photosynthetic organisms from cyanobacteria to higher plants including Nicotiana tabacum . Functional studies demonstrate that the role of CP47 as a proximal antenna and structural component of PSII is maintained across species, though subtle differences exist in the efficiency of energy transfer and the stability of protein-protein interactions within the complex. The assembly pathway involving pre-CP47 complex formation followed by integration into larger PSII assemblies appears to be conserved from cyanobacteria to higher plants, though the specific auxiliary factors involved may vary . Interestingly, while the core function of CP47 is conserved, the regulation of psbB gene expression shows species-specific differences, with tobacco and other higher plants having evolved more complex regulatory mechanisms compared to cyanobacteria, reflecting the compartmentalization of the gene in the chloroplast genome and the need for coordination with nuclear-encoded factors .

What can be learned from heterologous expression of CP47 across different host systems?

Heterologous expression of CP47 across different host systems provides valuable insights into the requirements for proper folding, assembly, and function of this complex membrane protein. Expression of tobacco CP47 in cyanobacterial systems like Synechocystis reveals the degree of functional conservation, as cyanobacterial assembly machinery can recognize and process plant CP47 to some extent, though with lower efficiency than the native protein . The challenges encountered in expressing functional CP47 in E. coli or yeast systems highlight the specialized nature of the chloroplast protein synthesis and membrane integration machinery, particularly the coordinated action of translation, membrane insertion, and assembly factors that are absent in these heterologous hosts . Expression attempts in insect or mammalian cell systems typically result in protein aggregation or improper membrane targeting, underscoring the unique lipid environment and insertase machinery required for CP47 integration. The most successful heterologous expression has been achieved in closely related plant species, suggesting that species-specific factors may influence CP47 folding and assembly despite high sequence conservation . Chimeric constructs combining domains from different species have helped identify which regions of CP47 are most sensitive to species-specific folding environments. These comparative expression studies collectively demonstrate that proper CP47 assembly requires not just the protein sequence itself but also a compatible membrane environment, appropriate assembly factors (like FPB1 and PAM68 homologs), and coordinated synthesis of other PSII components with which CP47 interacts during the assembly process .

How should researchers interpret contradictory data in CP47 functional studies?

When confronted with contradictory data in CP47 functional studies, researchers should implement a systematic analytical approach that considers multiple potential sources of variability. Experimental conditions represent a primary source of discrepancies, as factors like light intensity, temperature, and growth stage significantly impact PSII function and CP47 turnover rates; for instance, studies conducted under high light conditions may show different phenotypes than those under moderate light due to differential effects on photoinhibition and repair processes . Genetic background differences between studies can influence results, as the tobacco varieties used may contain polymorphisms in genes encoding assembly factors or other PSII components that interact with CP47, modifying the observed phenotypes . Technical variations in protein extraction methods can lead to differential recovery of CP47 from membrane fractions, potentially biasing quantitative comparisons between studies . Detection methods vary in sensitivity and specificity, with antibody-based detection being influenced by epitope accessibility in different sample preparation methods, while spectroscopic measurements reflect only the population of correctly folded, pigment-bound CP47 . The developmental stage of plants used in experiments significantly affects the composition and activity of the photosynthetic apparatus, necessitating careful standardization and reporting of plant age and growth conditions . To resolve contradictions, researchers should directly compare methods through side-by-side experiments, employ multiple complementary techniques to assess CP47 function, and consider physiological context when interpreting results from different experimental systems or conditions.

How can researchers effectively compare results from different CP47 detection and quantification methods?

Comparing results from different CP47 detection and quantification methods requires careful consideration of each technique's strengths, limitations, and the specific aspects of the protein they measure. Cross-calibration experiments represent an essential approach where the same set of samples is analyzed using multiple methods (e.g., Western blotting, mass spectrometry, and spectroscopic measurements), establishing conversion factors and correlation relationships between different quantification scales . Researchers should recognize the fundamental differences in what each method measures – immunological methods detect epitope availability regardless of protein functionality, while spectroscopic methods primarily detect correctly folded, pigment-binding CP47, leading to potential discrepancies in absolute quantification . Standard addition approaches using purified recombinant CP47 as an internal standard can help normalize results across different detection platforms and establish absolute quantification in different sample types. Method-specific biases should be systematically documented and accounted for, such as extraction efficiency differences for membrane proteins between detergent solubilization protocols or the potential underrepresentation of hydrophobic peptides in mass spectrometry analyses . Researchers should preferentially compare trends rather than absolute values when integrating data from different methodologies, focusing on relative changes under different experimental conditions or genetic backgrounds rather than absolute protein quantities. Meta-analysis approaches can be valuable for integrating results across multiple studies using different detection methods, particularly when sufficient methodological details are reported to account for systematic differences. Finally, reporting comprehensive metadata about sample preparation, detection methods, and quantification approaches is essential for enabling meaningful comparisons between studies and facilitating future meta-analyses of CP47 research.

What emerging technologies might advance our understanding of CP47 structure and function?

Emerging technologies offer promising avenues for deeper insights into CP47 structure and function in Nicotiana tabacum. Cryo-electron tomography combined with subtomogram averaging is poised to reveal the in situ organization of CP47 within native thylakoid membranes, providing contextual information about its interactions with other PSII components and auxiliary factors in a near-native environment . Advanced mass spectrometry approaches, including hydrogen-deuterium exchange mass spectrometry (HDX-MS) and cross-linking mass spectrometry (XL-MS), can map dynamic structural changes and protein-protein interactions of CP47 during assembly and under different physiological conditions . Time-resolved serial femtosecond crystallography using X-ray free-electron lasers allows visualization of structural changes in CP47 and associated pigments during light-induced excitation, providing unprecedented insights into the mechanisms of energy transfer from antenna chlorophylls to the reaction center . CRISPR-Cas9 genome editing combined with high-throughput phenotyping enables systematic mutagenesis of CP47 in vivo, creating libraries of variants for structure-function studies without the limitations of traditional transformation methods . Single-molecule techniques including atomic force microscopy and single-molecule FRET can probe the dynamics and conformational changes of individual CP47 molecules or complexes, revealing heterogeneity that might be masked in ensemble measurements. Integrative structural biology approaches combining complementary techniques (crystallography, cryo-EM, NMR, mass spectrometry) with computational modeling will likely provide the most comprehensive structural models of CP47 within the PSII complex, capturing both stable and dynamic features of this important protein.

What are the most promising approaches for enhancing recombinant CP47 production for research applications?

Several innovative strategies show promise for overcoming current limitations in recombinant CP47 production for research applications. Development of optimized chloroplast transformation vectors with inducible promoters and enhanced translation efficiency elements can increase expression levels while allowing temporal control to minimize toxicity from overexpression . Co-expression systems that simultaneously produce CP47 along with key assembly factors like FPB1 and PAM68 may overcome bottlenecks in membrane integration and folding, as these factors have been shown to facilitate the critical step when the last transmembrane domain emerges from the ribosomal tunnel . Cell-free expression systems supplemented with thylakoid membrane vesicles and purified assembly factors offer an alternative approach that allows precise control over the expression environment while bypassing potential toxicity issues associated with in vivo overexpression . Fusion protein strategies incorporating solubility-enhancing tags that can be subsequently removed may improve initial folding and membrane integration, though careful design is needed to ensure these modifications don't interfere with the complex membrane topology of CP47. Directed evolution approaches applied to CP47 or its assembly factors could potentially yield variants with enhanced expression or stability properties while maintaining functional characteristics. Systematic optimization of growth conditions, particularly light intensity, temperature, and nutrient composition, may significantly improve yields by creating an environment that balances protein synthesis with proper folding and assembly. For structural studies requiring large amounts of protein, heterologous expression in green algae like Chlamydomonas reinhardtii presents a promising compromise between the authenticity of higher plant systems and the rapid growth and genetic tractability of microbial systems .

What are the most critical unanswered questions regarding CP47 assembly into PSII?

Despite significant advances in understanding CP47 and PSII assembly, several fundamental questions remain unanswered that represent critical areas for future research. The precise molecular mechanism by which assembly factors like FPB1 and PAM68 facilitate the membrane integration of CP47, particularly during the observed ribosome stalling when the last transmembrane domain emerges, remains poorly understood and requires further structural and functional characterization of these assembly factor complexes . The timing and mechanism of chlorophyll attachment to CP47 during its synthesis and folding represents another significant knowledge gap – whether chlorophylls are inserted co-translationally or post-translationally, and which proteins coordinate this process in addition to the known chlorophyll synthesis enzymes . The specific molecular signals or structural features that determine the sorting of CP47 to particular regions of the thylakoid membrane system where PSII assembly occurs remain undefined, despite the importance of spatial organization for efficient assembly . The complete pathway and kinetics of CP47 assembly into progressively larger PSII subcomplexes needs further elucidation, particularly regarding the role of specific small subunits in stabilizing these intermediates . The relationship between CP47 synthesis/assembly and the complex chloroplast gene expression regulatory networks remains incompletely characterized, especially how these pathways respond to changing environmental conditions and developmental signals . The specific molecular mechanisms by which photoinhibition damages CP47 and triggers PSII repair, and how proteins like PsbN facilitate this repair process, require further investigation to develop strategies for enhancing photosynthetic efficiency under stress conditions . Addressing these questions will require integrating advanced structural biology approaches with in vivo functional studies and systems biology perspectives to build a comprehensive model of CP47 biogenesis and function within the dynamic context of the photosynthetic apparatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.