Recombinant Nicotiana tabacum Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Reaction Center Assembly

  • PsbD forms a heterodimer with D1 (PsbA) to create the PSII RC core, which binds chlorophylls, pheophytin, and quinones .

  • Co-translational insertion of D2 into thylakoid membranes is essential for RC complex stabilization .

Photoinhibition Repair

  • D2 turnover is critical during PSII repair cycles. Mutations disrupting D2 synthesis impair recovery from photoinhibition .

  • The C-terminal processing protease CtpA2 is required for D1 maturation, which directly interacts with D2 during RC assembly .

Transcriptional Regulation

  • The psbD promoter contains light-responsive elements (e.g., AAG-box) activated by blue/UV-A light and circadian rhythms .

Expression Systems

  • Bacterial Systems: E. coli is widely used for high-yield production of His-tagged PsbD .

  • Plant-Based Systems: Nicotiana tabacum cv. I 64 shows superior transient expression efficiency for recombinant proteins, including PsbD .

Challenges

  • PSII assembly in vascular plants is not limited by D2 synthesis, unlike in cyanobacteria or algae .

  • Overexpression of psbD mRNA increases transcript levels of co-transcribed psbC (CP43) but does not enhance PSII accumulation .

Mutational Studies

  • psbN Mutants: Disruption of the PsbN gene (adjacent to psbD) reduces PSII accumulation by 75%, highlighting its role in RC assembly .

  • Shine–Dalgarno Mutations: Altering the psbD 5'-UTR reduces translation efficiency but does not limit PSII biogenesis in tobacco .

Future Directions

Research priorities include elucidating D2’s role in Mn4O5Ca cluster assembly and optimizing plant-based platforms for scalable PsbD production. Advances in chloroplast engineering could enhance PSII stability under stress conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format when placing your order, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, and the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
psbD
Target Protein Sequence
MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently utilized for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 plays a crucial role in assembling a stable PSII complex.
Database Links

KEGG: nta:800525

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the D2 protein and what role does it play in Photosystem II?

The D2 protein, encoded by the chloroplast psbD gene, is a core reaction center subunit of Photosystem II (PSII). It functions as part of the heterodimeric reaction center alongside the D1 protein, forming the heart of the PSII complex that drives oxygenic photosynthesis. The D2 protein binds multiple cofactors involved in electron transport, including chlorophyll, pheophytin, and plastoquinone molecules that are essential for the primary photochemistry of PSII. In tobacco and other vascular plants, D2 serves as a structural scaffold for the assembly of other PSII components, including the oxygen-evolving complex. Unlike in cyanobacteria and green algae such as Chlamydomonas reinhardtii, the biosynthesis of D2 does not appear to be the rate-limiting step for PSII accumulation in vascular plants, suggesting different evolutionary adaptations in the regulation of photosynthetic apparatus . The protein is subject to various post-translational modifications that influence its stability, function, and integration into the PSII complex.

How is the psbD gene organized in the tobacco chloroplast genome?

The psbD gene in Nicotiana tabacum is located in the chloroplast genome and is co-transcribed with the psbC gene, which encodes the CP43 inner antenna protein of PSII. This gene arrangement creates a polycistronic transcript containing both genes, with regulatory elements in the 5′-untranslated region (5′-UTR) controlling expression of both proteins. The psbD gene contains important regulatory sequences including a Shine-Dalgarno-like sequence in its 5′-UTR that interacts with the anti-Shine-Dalgarno sequence in the 16S ribosomal RNA to position the translation initiation complex near the start codon . This positioning is critical for efficient translation, as demonstrated by studies where mutations in the anti-Shine-Dalgarno sequence severely affected psbD translation. The organization of the psbD gene in the context of other photosynthetic genes in the chloroplast genome reflects the coordinated regulation needed for stoichiometric production of PSII components. Interestingly, on the opposite DNA strand relative to the psbB gene cluster lies the psbN gene, which although not a constituent of PSII, is required for efficient assembly of the PSII reaction center .

What are the optimal approaches for expressing recombinant psbD in tobacco?

The expression of recombinant psbD in tobacco requires sophisticated chloroplast transformation techniques, as the gene is natively encoded in the chloroplast genome. For successful expression, researchers should employ biolistic transformation using a chloroplast transformation vector containing the modified psbD gene with appropriate regulatory elements. The regulatory 5′-untranslated region (5′-UTR) of psbD is particularly important for controlling expression levels, as modifications to this region have been shown to significantly affect transcript abundance and translation efficiency . When designing expression constructs, the Shine-Dalgarno-like sequence in the 5′-UTR should be preserved or strategically modified, as it plays a crucial role in translation initiation. For stable transformation, homologous recombination regions flanking the transgene facilitate proper integration into the chloroplast genome, followed by selection under spectinomycin or other appropriate markers. Multiple rounds of regeneration under selection pressure are necessary to achieve homoplasmy (complete replacement of wild-type chloroplast genomes). Notably, among Nicotiana varieties, Nicotiana tabacum (cv. I 64) has demonstrated superior performance for recombinant protein production, with the highest transient expression levels combined with substantial biomass production and relatively low alkaloid content .

What analytical techniques are most effective for quantifying D2 protein in transgenic tobacco?

Effective quantification of D2 protein in transgenic tobacco requires a combination of complementary analytical techniques to ensure accurate assessment. Immunoblot analysis using specific antibodies against D2 provides a primary method for detecting and semi-quantifying the protein, with calibration curves using purified recombinant D2 as standards enabling more precise quantification. For higher sensitivity and specificity, mass spectrometry-based approaches including selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can detect D2-specific peptides, allowing absolute quantification even in complex thylakoid membrane preparations. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by second-dimension SDS-PAGE offers insights into the assembly state of D2 within various PSII subcomplexes and supercomplexes, revealing information beyond mere protein abundance. Pulse-chase labeling with 35S-methionine enables assessment of D2 synthesis rates and turnover dynamics, particularly important given the rapid turnover of PSII components under photodamage conditions. Complementary spectroscopic measurements of PSII activity, including oxygen evolution rates, chlorophyll fluorescence parameters (Fv/Fm, ΦPSII), and P680+ reduction kinetics, provide functional correlates to D2 protein levels, offering a comprehensive view of how alterations in D2 expression affect PSII performance .

How can researchers verify proper assembly of recombinant D2 into functional PSII complexes?

Verifying proper assembly of recombinant D2 into functional PSII complexes requires a multi-faceted approach combining structural and functional analyses. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting with antibodies against D2 and other PSII subunits provides visual confirmation of D2 incorporation into PSII monomers, dimers, and supercomplexes. Researchers should complement this with sucrose density gradient ultracentrifugation to isolate intact PSII complexes, followed by proteomic analysis to confirm the presence of all expected subunits in stoichiometric ratios. Functional verification through spectroscopic techniques is essential, including measurement of oxygen evolution capacity, variable chlorophyll fluorescence (Fv/Fm ratio), and thermoluminescence to assess charge recombination events characteristic of functional PSII. Electron paramagnetic resonance (EPR) spectroscopy can verify proper formation of the manganese cluster and associated cofactors. Additionally, researchers should examine photosynthetic electron transport rates and P680+ reduction kinetics, as these directly reflect reaction center functionality. Studies have shown that proper PSII assembly depends not only on D2 availability but also on auxiliary factors like PsbN, which, while not a constituent subunit of PSII, is crucial for the assembly of the heterodimeric PSII reaction center and recovery from photoinhibition . Complete functional verification should include light sensitivity tests, as improperly assembled complexes often show increased susceptibility to photodamage.

How do post-translational modifications affect recombinant D2 protein stability and function?

Post-translational modifications significantly impact recombinant D2 protein stability and function in tobacco, with N-terminal deformylation serving as a critical initial processing step. After translation on chloroplast ribosomes, D2 protein synthesis begins with N-formyl-methionine as the initiating residue, and the removal of this formyl group by peptide deformylase is essential for subsequent protein processing . Studies using the peptide deformylase inhibitor actinonin demonstrate that inhibiting this modification in tobacco results in decreased accumulation of the D1 protein (which pairs with D2 in the PSII reaction center), ultimately reducing functional PSII complexes . Though these studies focused primarily on D1, the same processing pathway applies to D2, and impairment would similarly affect its stability and incorporation into PSII. Beyond deformylation, D2 undergoes methionine excision and potentially other modifications that influence its folding, membrane insertion, and association with cofactors and partner proteins. The proper coordination of these post-translational events is crucial for D2 function, as improper processing leads to protein degradation rather than incorporation into stable PSII complexes. The tight regulation of these modifications helps explain why simply overexpressing D2 does not increase PSII accumulation, as excess unmodified or improperly modified protein would be targeted for degradation rather than assembled into functional complexes .

What strategies can overcome challenges in expressing and purifying functional recombinant D2 protein?

Successfully expressing and purifying functional recombinant D2 protein presents significant challenges that require specialized approaches. Since D2 is an integral membrane protein with multiple transmembrane helices, researchers should employ chloroplast transformation rather than nuclear transformation to ensure proper targeting and folding. The transformation vector should include not only the psbD coding sequence but also its native 5'-UTR to maintain proper translation regulation, though modifications can be made to enhance expression . To improve protein stability during assembly, co-expression of key interaction partners like D1 and assembly factors may be necessary. For purification, researchers should use a gentle solubilization approach with mild detergents like n-dodecyl-β-D-maltoside (β-DDM) or digitonin to maintain protein-protein interactions and structural integrity. Affinity tags should be strategically placed to minimize interference with protein folding and function, with C-terminal tags generally preferred over N-terminal ones due to the importance of N-terminal processing for proper D2 maturation . Column purification should employ gradient elution under conditions that maintain the native lipid environment as much as possible. Verification of proper folding can be assessed through circular dichroism spectroscopy to confirm secondary structure content, while functionality can be evaluated through cofactor binding assays and reconstitution experiments. For highest yields of recombinant protein, Nicotiana tabacum (cv. I 64) has demonstrated superior performance among tobacco varieties, producing high protein concentrations with substantial biomass and relatively low alkaloid content .

How can researchers investigate the dynamic assembly process of D2 into PSII complexes?

Investigating the dynamic assembly process of D2 into PSII complexes requires sophisticated temporal and spatial resolution techniques that capture the sequential steps of complex formation. Pulse-chase labeling with radioisotopes (35S-methionine) or stable isotopes (for mass spectrometry) allows researchers to track newly synthesized D2 protein as it progresses through assembly intermediates to mature complexes. Samples collected at various time points can be analyzed by blue native PAGE followed by second-dimension SDS-PAGE or by sucrose gradient ultracentrifugation to separate assembly intermediates. Complementary approaches include in vivo protein labeling with fluorescent tags combined with fluorescence recovery after photobleaching (FRAP) or Förster resonance energy transfer (FRET) to monitor protein movement and interactions within the thylakoid membrane. Time-resolved cryo-electron microscopy can provide structural snapshots of assembly intermediates, revealing the architectural changes during PSII biogenesis. Researchers should also consider the roles of assembly factors, particularly PsbN, which has been proven essential for assembly of the heterodimeric PSII reaction center despite not being a constituent subunit of mature PSII . Studies have shown that tobacco mutants lacking functional PsbN have severely impaired formation of heterodimeric PSII reaction centers and higher-order PSII assemblies, even though assembly of PSII precomplexes occurs at normal rates . These approaches collectively provide insights into the spatiotemporal dynamics of D2 incorporation into functional PSII.

What experimental designs can assess D2 protein turnover during photoinhibition and repair?

Robust experimental designs for assessing D2 protein turnover during photoinhibition and repair cycles should incorporate multiple complementary approaches tracking protein dynamics under varying light conditions. Pulse-chase experiments using radioisotope labeling with 35S-methionine allow precise quantification of D2 synthesis and degradation rates during high light exposure and subsequent recovery periods. These experiments should include control samples maintained under non-photoinhibitory conditions to establish baseline turnover rates. Researchers should implement a photoperiod regime with defined high light stress periods (1000-2000 μmol photons m-2 s-1) followed by recovery under growth light conditions (100-200 μmol photons m-2 s-1), collecting samples at multiple timepoints for immunoblot analysis of D2 protein levels. Chlorophyll fluorescence measurements (Fv/Fm, NPQ, ΦPSII) conducted in parallel provide functional correlates of PSII damage and recovery. To distinguish between de novo synthesis and repair, protein synthesis inhibitors like lincomycin or chloramphenicol should be applied to separate subsets of samples. For deeper mechanistic insights, researchers should examine the key auxiliary factors in the repair process, including the role of PsbN, which has been demonstrated as essential for efficient repair from photoinhibition . The experimental design should incorporate tobacco mutants with altered expression of potential assembly/repair factors to elucidate their specific contributions to D2 turnover dynamics.

What insights can comparative studies of D2 across species provide for photosynthesis research?

Comparative studies of D2 protein across species offer profound insights into evolutionary adaptations of photosynthetic mechanisms and identify conserved versus species-specific features that can advance photosynthesis research. The psbD gene shows remarkable conservation across photosynthetic organisms, reflecting the fundamental role of D2 in PSII function, yet subtle sequence variations correlate with physiological adaptations to different light environments and stress conditions. Research has revealed significant differences in regulatory mechanisms controlling PSII accumulation between cyanobacteria, green algae like Chlamydomonas reinhardtii, and vascular plants like Nicotiana tabacum . While D2 biosynthesis limits PSII accumulation in cyanobacteria and C. reinhardtii, neither transcription nor translation of psbD is rate-limiting for PSII biogenesis in tobacco, suggesting distinct evolutionary solutions to coordinating photosystem assembly . Comparative genomic analyses of psbD promoter regions and 5'-UTRs across species can identify regulatory elements that have evolved to fine-tune expression under different environmental conditions. Similarly, examining variations in D2 protein sequences, particularly at sites involved in cofactor binding or protein-protein interactions, can reveal adaptive strategies for optimizing photosynthetic performance. These comparative approaches provide valuable contexts for interpreting experimental results from model systems and can guide the transfer of beneficial traits between species through targeted genetic engineering.

How might CRISPR-based technologies advance research on chloroplast-encoded psbD?

CRISPR-based technologies offer revolutionary potential for advancing research on chloroplast-encoded psbD, though their application to chloroplast genomes presents unique challenges and opportunities. Traditional chloroplast transformation relies on homologous recombination following biolistic delivery of DNA constructs, requiring lengthy selection processes to achieve homoplasmy. Emerging CRISPR-Cas9 systems adapted for chloroplast genome editing could dramatically accelerate the generation of precise psbD variants by directly editing the gene in situ rather than replacing it through homologous recombination. For effective chloroplast genome editing, researchers must overcome several challenges: developing chloroplast-targeted Cas9 protein with appropriate transit peptides, designing efficient guide RNAs compatible with the unique properties of chloroplast DNA, and establishing reliable delivery methods for the CRISPR-Cas9 components into the chloroplast. These technologies could enable rapid creation of libraries of psbD variants with specific mutations in functional domains, regulatory elements, or interaction interfaces, allowing high-throughput screening for enhanced photosynthetic performance or stress resistance. CRISPR interference (CRISPRi) approaches using catalytically inactive Cas9 could provide precise temporal control over psbD expression, facilitating studies of D2 protein turnover dynamics without permanent genetic modifications. Additionally, base editing and prime editing technologies adapted for chloroplasts could allow introduction of specific nucleotide changes without double-strand breaks, minimizing potential disruption to the highly organized chloroplast genome.

What is the recommended protocol for isolating intact PSII complexes containing recombinant D2 protein?

The isolation of intact PSII complexes containing recombinant D2 protein requires careful execution to maintain structural integrity and functionality. Begin with 50-100g of fresh young tobacco leaves harvested in the morning to ensure optimal photosynthetic protein content. Homogenize leaves in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 5 mM MgCl₂, 10 mM NaCl, 2 mM EDTA, 1% BSA) using a blender with 3-5 short pulses, followed by filtration through four layers of miracloth. Centrifuge the filtrate at 1,000g for 5 minutes to pellet chloroplasts, then resuspend and osmotically shock them in lysis buffer (5 mM MgCl₂, 10 mM NaCl, 20 mM HEPES-KOH pH 7.5) for 30 minutes on ice to release thylakoids. Collect thylakoids by centrifugation at 6,000g for 10 minutes, then solubilize them in 20 mM MES-NaOH pH 6.0, 10 mM MgCl₂, 5 mM CaCl₂, 10 mM NaCl with 1% n-dodecyl-β-D-maltoside (β-DDM) at a chlorophyll concentration of 1 mg/mL for 30 minutes on ice with gentle agitation. Remove unsolubilized material by centrifugation at 20,000g for 10 minutes, then separate the complexes by sucrose density gradient ultracentrifugation (0.1-1.0 M sucrose, 20 mM MES-NaOH pH 6.0, 10 mM MgCl₂, 5 mM CaCl₂, 10 mM NaCl, 0.03% β-DDM) at 200,000g for 16 hours at 4°C. Collect the dark green band corresponding to PSII complexes, verify integrity by blue native gel electrophoresis, and confirm oxygen evolution activity using a Clark-type electrode with artificial electron acceptors .

StepProcedureCritical Parameters
1. Tissue CollectionHarvest 50-100g young leaves in morningUse pre-flowering plants grown under controlled light
2. HomogenizationBlend in isolation buffer, filterKeep cold, use short pulses to minimize heat
3. Chloroplast IsolationCentrifuge 1,000g, 5 minGentle resuspension to maintain integrity
4. Osmotic ShockIncubate in lysis buffer, 30 minMaintain on ice throughout
5. Thylakoid CollectionCentrifuge 6,000g, 10 minAvoid overcentrifugation
6. Solubilization1% β-DDM, 30 min, on iceCritical: 1 mg/mL chlorophyll concentration
7. Gradient Centrifugation200,000g, 16 hours, 4°CUse freshly prepared gradients
8. PSII CollectionExtract dark green bandMinimize light exposure
9. VerificationBN-PAGE and oxygen evolution assayStore at -80°C with 10% glycerol for preservation

How can researchers troubleshoot common issues in recombinant D2 protein expression?

Researchers encountering difficulties with recombinant D2 protein expression in tobacco can implement systematic troubleshooting approaches to identify and resolve specific issues. When confronting low transformation efficiency, optimize biolistic parameters including helium pressure (1100-1350 psi), microcarrier size (0.6 μm gold particles), and DNA coating conditions (presence of spermidine and CaCl₂). Maintain proper antibiotic selection pressure (typically 500 mg/L spectinomycin) throughout multiple regeneration cycles to ensure homoplasmy, as heteroplasmic plants will show unstable expression. For poor D2 protein accumulation despite confirmed transgene integration, verify transcript levels through northern blotting, as mutations in the psbD 5'-UTR can drastically reduce mRNA abundance and consequently protein levels . If mRNA levels are adequate but protein accumulation remains low, examine translation efficiency using polysome profiling to determine if ribosome association is impaired. Consider that mutations in the Shine-Dalgarno-like sequence or start codon significantly affect translation initiation . For proper protein expression but defective PSII assembly, investigate the status of assembly factors like PsbN, which is critical for heterodimeric reaction center formation despite not being a constituent of mature PSII . Problems with photosensitivity or photoinhibition might indicate impaired D2 turnover or repair mechanisms, necessitating analysis of protein synthesis rates under light stress conditions. In all cases, comparative analysis with wild-type controls at each step (transcription, translation, assembly, function) will help pinpoint the specific stage where the process fails.

What methods can accurately assess the functional integration of recombinant D2 into PSII?

Accurate assessment of recombinant D2 functional integration into PSII requires a multi-parameter approach combining biochemical, biophysical, and spectroscopic techniques. Chlorophyll fluorescence measurements provide a non-invasive primary screen, with parameters including maximum quantum efficiency (Fv/Fm), operating efficiency (ΦPSII), and non-photochemical quenching (NPQ) reflecting PSII functionality. When properly integrated, recombinant D2 should support Fv/Fm values approaching 0.8, similar to wild-type plants. Oxygen evolution measurements using a Clark-type electrode with artificial electron acceptors (1 mM 2,6-dichloro-p-benzoquinone plus 1 mM potassium ferricyanide) provide quantitative data on water-splitting activity, with rates typically ranging from 400-600 μmol O₂/mg chlorophyll/hour for fully functional complexes. Thermoluminescence measurements detect charge recombination events characteristic of properly assembled PSII reaction centers, with the temperature of the B-band (S₂/S₃QB⁻ recombination) serving as a sensitive indicator of D2-QB pocket integrity. Electron paramagnetic resonance (EPR) spectroscopy can verify proper formation of the non-heme iron center coordinated between D1 and D2, with characteristic g=6 and g=4.3 signals. For direct visualization of complex assembly, blue native PAGE followed by western blotting with D2-specific antibodies confirms incorporation into higher-order PSII complexes (monomers, dimers, supercomplexes). Flash-induced absorption spectroscopy measuring P680⁺ reduction kinetics provides insight into electron transfer events dependent on proper D2 integration . These complementary approaches collectively provide a comprehensive assessment of functional integration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.