Recombinant Nicotiana tabacum Probable aquaporin TIP-type RB7-18C

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

  • Water Transport: Facilitates bidirectional water flux across vacuolar membranes .

  • Gas Permeability: Demonstrates CO2_2 permeability in chloroplast membranes, challenging earlier assumptions about membrane gas diffusion .

  • Additional Substrates: Functional screens in yeast suggest involvement in hydrogen peroxide (H2_2O2_2) and urea transport .

Production and Purification

The protein is produced via heterologous expression in E. coli with the following workflow:

  1. Cloning: Full-length cDNA (1–250 aa) is inserted into a vector with a His-tag sequence .

  2. Expression: Induced in E. coli under optimized conditions for soluble protein yield .

  3. Purification: Affinity chromatography using Ni-NTA columns, followed by buffer exchange into storage-compatible formulations .

ParameterSpecification
Expression SystemE. coli BL21(DE3)
Yield~1–2 mg/L culture (varies by batch)
StabilityStable at -80°C for 12 months (lyophilized)
ApplicationsSDS-PAGE, functional assays, antibody production

Key Studies

  1. CO2_2 Transport in Chloroplasts

    • RB7-18C contributes to CO2_2 conductance in chloroplast membranes, enhancing photosynthetic efficiency by 20% in transgenic tobacco lines .

    • RNAi-mediated knockdown reduced CO2_2 permeability by 56% in isolated chloroplast membranes .

  2. Transgene Expression Enhancement

    • The RB7 matrix attachment region (MAR) increases transgene expression likelihood (10% vs. 45% non-expressing cells in controls) and magnitude (1.9- to 2.9-fold) .

  3. Biotechnological Utility

    • Used in plant glycoengineering to produce recombinant proteins with humanized glycosylation profiles .

    • Serves as a model for studying vacuolar solute dynamics and drought resistance mechanisms .

Challenges in Recombinant Production

  • Genetic Instability: T-DNA vectors containing the 35S promoter are prone to transposon insertion from Agrobacterium tumefaciens Ti plasmids, necessitating genetic insulators like the RB7 SAR sequence .

  • Storage Limitations: Repeated freeze-thaw cycles degrade protein integrity; working aliquots stored at 4°C retain functionality for ≤1 week .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve pore dynamics and substrate specificity .

  • Crop Engineering: Leveraging RB7-18C’s water transport efficiency to develop drought-resistant tobacco variants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
Probable aquaporin TIP-type RB7-18C; RT-TIP; TobRB7; Tonoplast intrinsic protein, root-specific RB7-18C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Protein Sequence
MVLIAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFIGCHTPLPTSEDYA
Uniprot No.

Target Background

Function
A tonoplast channel protein. These proteins potentially facilitate the diffusion of amino acids and/or peptides between the vacuolar compartment and the cytoplasm.
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Roots.

Q&A

What is Nicotiana tabacum Probable Aquaporin TIP-type RB7-18C?

Nicotiana tabacum probable aquaporin TIP-type RB7-18C is a membrane transport protein belonging to the Tonoplast Intrinsic Protein (TIP) subfamily of aquaporins found in tobacco plants (Nicotiana tabacum). This protein is primarily localized to the tonoplast, which is the membrane surrounding the plant vacuole. The RB7 designation relates to its genomic origin near the Rb7 matrix attachment region, which has been shown to enhance transgene expression in plants. These proteins form tetrameric structures in cellular membranes with each monomer containing a central pore that facilitates the bidirectional transport of water and potentially other small, uncharged molecules across the membrane .

The full-length protein consists of 250 amino acids and functions as part of a dynamic solute transport network that facilitates movement of water and other vital solutes across various cellular membranes . As a member of the TIP subfamily, it plays critical roles in maintaining cellular water homeostasis and may be involved in various physiological processes including drought response and oxidative stress management.

How do TIP-type Aquaporins Differ from Other Plant Aquaporin Subfamilies?

Plant aquaporins have evolved into several distinct subfamilies, with TIP, PIP (Plasma membrane Intrinsic Proteins), and NIP (Nodulin 26-like Intrinsic Proteins) representing the three largest groups. These subfamilies differ in several key aspects:

CharacteristicTIP SubfamilyPIP SubfamilyNIP Subfamily
Primary LocalizationTonoplast (vacuolar membrane)Plasma membraneVarious membranes including symbiosome
Transport SelectivityWater, H₂O₂, urea, ammoniaPrimarily water, CO₂Diverse solutes including boron, silicon
Structural FeaturesShorter N-terminal regionLonger N-terminal regionVariable loop regions
Expression PatternsOften tissue-specificGenerally constitutiveOften nodule or root-specific
Response to StressMany responsive to drought, saltSome responsive to hydraulic signalsSome responsive to nutrient deficiency

TIP-type aquaporins like RB7-18C typically exhibit greater transport diversity than PIPs, with the ability to transport various small, uncharged molecules in addition to water . AlphaFold protein models have illustrated differences in pore shape and size across these subfamilies, which contribute to their distinct functional properties. The TIP subfamily typically has wider pore structures that may accommodate larger solutes compared to the more selective PIPs .

What Are the Primary Transport Functions of TIP-type RB7-18C?

Based on research with similar tobacco aquaporins, TIP-type RB7-18C likely mediates the transport of several physiologically relevant molecules:

  • Water transport: Flow cytometry studies using GFP expression in tobacco cells have shown that TIP aquaporins facilitate water movement across the tonoplast, contributing to cellular water homeostasis and potentially drought tolerance mechanisms. Expression of certain TIPs allowed yeast to survive freeze-thaw cycles, indicating water transport capabilities across the membrane .

  • Hydrogen peroxide (H₂O₂) transport: Several TIP-type aquaporins have demonstrated the ability to transport H₂O₂, which functions as a signaling molecule in stress responses. This transport function may be particularly important during drought stress, as seen in the dramatic upregulation (approximately 5000-fold) of some TIP isoforms during water deficit conditions .

  • Small molecule transport: Functional characterization of tobacco aquaporins using yeast-based screening has identified novel candidates for boric acid and urea transport across the TIP subfamily . These transport capabilities suggest roles in nitrogen metabolism and micronutrient homeostasis.

It's worth noting that the specific transport capabilities of RB7-18C would need to be verified experimentally, as functional diversity exists even within the TIP subfamily.

What Expression Systems Are Most Effective for Recombinant Production of Plant Aquaporins?

The choice of expression system for recombinant production of plant aquaporins depends on research objectives, required protein quantity, and downstream applications. Several systems have proven effective:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, rapid growth, cost-effectiveLacks plant-specific post-translational modifications, membrane insertion challengesStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic processing, functional assays possible, aquaporin-deficient strains availableLower yield than bacteriaFunctional characterization, transport assays
Plant cell culturesNative post-translational modifications, proper foldingLower yield, more time-consumingPhysiological studies, trafficking analysis
Baculovirus/insect cellsHigh expression of membrane proteins, eukaryotic processingMore expensive, technically demandingStructural studies requiring eukaryotic modifications

For RB7-18C specifically, E. coli has been used successfully to produce recombinant full-length protein with His-tag modifications . When conducting functional studies, yeast expression systems have proven particularly valuable, as demonstrated in comprehensive studies of Nicotiana tabacum aquaporins where high-throughput yeast-based functional screens identified transport capabilities for water, hydrogen peroxide, boric acid, and urea .

The critical consideration is matching the expression system to experimental needs. For instance, if studying transport function, yeast systems often provide advantages due to the availability of aquaporin-deficient strains that minimize background activity and allow for clear assessment of transport function.

How Can Researchers Verify the Functionality of Recombinant TIP Aquaporins?

Verifying the functionality of recombinant TIP aquaporins requires multiple complementary approaches:

  • Yeast-based functional assays: Expression in aquaporin-deficient yeast strains allows for direct assessment of transport function. For water transport, freeze-thaw survival assays can measure protection against cellular damage. Studies have shown that expression of certain tobacco TIPs allowed yeast to survive two freeze-thaw cycles, achieving 30-70% of untreated growth compared to only 2% in control yeast expressing empty vector .

  • Stopped-flow spectrophotometry: This technique measures the rate of cell volume change in response to osmotic gradients, providing quantitative data on water permeability. Cells expressing functional aquaporins show faster volume changes compared to controls.

  • Transport-specific assays: Various approaches can assess transport of specific molecules:

    • For H₂O₂: Use of H₂O₂-sensitive fluorescent dyes in expressing cells

    • For boron: Growth assays in toxic boric acid concentrations

    • For urea: Isotope-labeled uptake studies

  • Subcellular localization verification: Using GFP fusion proteins to confirm proper membrane targeting is essential for functional interpretation. Studies of tobacco aquaporins have confirmed localization to expected membranes including plasma membrane, tonoplast, and endoplasmic reticulum .

  • Electrophysiological techniques: For aquaporins that may transport charged species, patch-clamp techniques can provide direct evidence of transport function.

A comprehensive approach combining multiple methods provides the most reliable functional verification. For example, in studies with tobacco aquaporins, researchers used both yeast-based screens and in planta GFP localization to correlate transport function with proper subcellular targeting .

What Methods Are Used to Study Aquaporin Response to Drought Stress?

Understanding how TIP-type aquaporins like RB7-18C respond to drought stress requires a multi-level analytical approach:

  • Transcriptional analysis: Quantitative PCR (qPCR) can measure changes in gene expression under drought conditions. Studies in barley have shown significant variation in transcriptional activity of TIP genes under drought stress, with some isoforms being down-regulated while others (particularly those involved in H₂O₂ transport) were dramatically up-regulated by as much as 5000-fold .

  • Protein abundance assessment: Western blotting with specific antibodies or proteomics approaches can quantify changes in protein levels. This is crucial as post-transcriptional regulation may result in differences between transcript and protein abundance.

  • Measurement of relative water content (RWC): This physiological parameter provides context for molecular changes. In barley studies, drought stress caused a 55% decrease in RWC, while re-watering increased RWC to 90% of control levels .

  • Promoter analysis: Examination of cis-regulatory elements in promoter regions can provide insights into stress-responsive regulation. Studies have identified hormone and stress-responsive elements in the promoters of TIP genes that correlate with their drought-responsive expression patterns .

  • Transgenic approaches: Overexpression or silencing of specific aquaporins followed by drought tolerance assessment can directly test functional significance.

To illustrate the dynamic nature of aquaporin expression during drought stress and recovery, researchers have tracked expression changes across treatment phases:

GeneNormal ConditionsDrought StressRe-watering
TIP1;1High expressionDown-regulatedReturn toward normal
TIP1;2High expressionDown-regulatedReturn toward normal
TIP2;3Highest expressionDown-regulatedReturn toward normal
TIP3;1Low expressionUp-regulated (~5000×)Partial return
TIP4;1Low expressionUp-regulatedPartial return

These patterns suggest differential roles for TIP subfamily members in drought response, with some potentially involved in water conservation and others in stress signaling .

How Does the Structure of TIP-type RB7-18C Contribute to Its Substrate Selectivity?

The structure-function relationship in TIP-type aquaporins is central to understanding their substrate selectivity. AlphaFold protein models have illustrated key differences in pore shape and size across aquaporin subfamilies that contribute to their distinct transport capabilities .

For TIP-type aquaporins, several structural features influence selectivity:

  • Pore-lining residues: The ar/R (aromatic/arginine) selectivity filter formed by four amino acid residues creates a constriction that determines which molecules can pass through. In TIPs, this filter is typically wider than in PIPs, allowing passage of larger molecules such as urea or hydrogen peroxide.

  • NPA motifs: These conserved asparagine-proline-alanine sequences form a second constriction site and contribute to proton exclusion. Any variations in these normally highly conserved motifs can significantly alter selectivity.

  • Loop regions: The extracellular loops, particularly Loop C, can influence substrate access to the pore. Variations in these regions between different TIPs may contribute to functional specialization.

  • Phosphorylation sites: Post-translational modification sites, particularly in the N- and C-terminal regions, can regulate channel activity through conformational changes that open or close the pore in response to environmental signals.

The integrated approach of combining AlphaFold protein modeling with functional data from yeast-based screens has proven valuable for deciphering unknown aquaporin structure-function relationships and uncovering novel candidates for specific solute transport . This approach can be particularly useful for predicting the transport capabilities of RB7-18C based on structural similarities to functionally characterized aquaporins.

What Roles Do TIP Aquaporins Play in Oxidative Stress Responses?

TIP aquaporins, including those similar to RB7-18C, play multifaceted roles in oxidative stress responses, primarily through their ability to transport hydrogen peroxide (H₂O₂) across membranes:

  • H₂O₂ signaling facilitation: By transporting H₂O₂ across the tonoplast, TIPs may facilitate the movement of this signaling molecule between cellular compartments, allowing it to reach target proteins and activate stress response pathways. The dramatic upregulation of certain TIP isoforms (e.g., HvTIP3;1 with approximately 5000-fold increase) under drought stress suggests their importance in stress-induced signaling .

  • Compartmentalization of oxidative damage: TIPs may help sequester H₂O₂ in the vacuole, protecting cytosolic components from oxidative damage while potentially using the vacuole as a reservoir for controlled release.

  • Interaction with antioxidant systems: There is evidence that aquaporin-mediated H₂O₂ transport works in concert with antioxidant systems to maintain appropriate cellular redox balance. The differential regulation of various TIP isoforms during stress conditions suggests specialized roles within this system.

  • Integration with hormonal signaling: Analysis of promoter regions of TIP genes has revealed the presence of cis-regulatory elements connected with hormone responses, suggesting coordination with stress hormone signaling pathways . This integration allows for complex regulation of oxidative stress responses.

The diverse expression patterns and regulatory mechanisms of TIP aquaporins indicate specialized roles in oxidative stress management. While some TIPs are downregulated during drought stress, potentially to conserve water, others like TIP3;1 are dramatically upregulated, suggesting primary roles in stress signaling rather than water transport .

How Does the Rb7 Matrix Attachment Region Influence Transgene Expression?

The Rb7 matrix attachment region (MAR), which shares its name origin with the RB7-18C aquaporin, has significant effects on transgene expression that make it valuable for biotechnological applications:

The ability of Rb7 MAR to increase both the likelihood and magnitude of transgene expression makes it particularly valuable for applications where consistent, high-level expression is required . While not directly related to the function of the RB7-18C aquaporin, understanding this genomic context provides valuable insight for researchers working with transgenic constructs involving this protein.

How Should Researchers Interpret Contradictory Data Regarding Aquaporin Transport Specificity?

When faced with contradictory data regarding aquaporin transport specificity, researchers should employ a systematic analytical approach:

What Controls Are Essential When Studying TIP Aquaporins in Drought Response?

  • Physiological controls:

    • Relative water content (RWC) measurements: Quantify drought severity consistently. Studies in barley demonstrated that drought stress caused a 55% decrease in RWC, while re-watering increased RWC to 90% of control levels .

    • Soil moisture monitoring: Standardize drought conditions across experiments.

    • Developmental stage matching: Compare plants at equivalent developmental stages to avoid confounding effects.

  • Molecular controls:

    • Multiple reference genes: Use at least 3 stable reference genes for qPCR normalization that have been verified to remain constant under drought conditions.

    • Time-course sampling: Include multiple time points to capture the dynamic nature of aquaporin expression responses.

    • Re-watering treatment: Include recovery phase measurements to distinguish between drought-specific responses and general stress responses. Research has shown that re-hydration causes expression of many genes to return to levels observed under optimal moisture conditions .

  • Experimental design controls:

    • Multiple biological replicates: Minimum of 3-5 independent experiments.

    • Genetic background standardization: Use isogenic lines when comparing transgenic plants.

    • Environmental parameter control: Maintain consistent light, temperature, and humidity conditions.

  • Validation controls:

    • Protein-level verification: Confirm that transcript changes correlate with protein abundance changes.

    • Promoter activity analysis: Verify the presence of drought-responsive cis-regulatory elements in promoter regions .

    • Subcellular localization confirmation: Ensure proper targeting of aquaporins to appropriate membranes under stress conditions.

  • Comparative controls:

    • Multiple aquaporin isoforms: Include various TIP subfamily members to identify specificity of responses.

    • Cross-species comparison: When possible, compare findings with homologous aquaporins in related species.

By implementing these controls, researchers can distinguish between direct drought-responsive functions of TIP aquaporins and secondary effects or experimental artifacts. This approach has successfully revealed that while some TIP aquaporins are downregulated during drought, others (particularly those involved in hydrogen peroxide transport) are dramatically upregulated, suggesting specialized roles in stress signaling .

How Can Functional Redundancy Among Aquaporin Family Members Be Addressed?

Plant aquaporin families typically consist of multiple members with potentially overlapping functions, presenting challenges for functional characterization. Several strategies can address this redundancy:

  • Comprehensive expression profiling:

    • Tissue-specific analysis: Determine where and when each aquaporin is expressed. Studies have shown that different TIP isoforms may predominate in different tissues or developmental stages.

    • Stress-responsive expression: Quantify expression changes under various stresses. For example, in barley, TIP3;1 showed a dramatic ~5000-fold increase under drought stress while other TIPs were downregulated, suggesting non-redundant functions .

    • Single-cell transcriptomics: Resolve cell-type specific expression patterns that may reveal specialized roles.

  • Advanced genetic approaches:

    • Higher-order mutants: Generate double, triple, or quadruple knockouts of closely related aquaporins to overcome redundancy.

    • Inducible silencing systems: Use tissue-specific or temporally controlled silencing to bypass developmental compensation.

    • CRISPR/Cas9 multiplexing: Target multiple aquaporin genes simultaneously.

  • Functional differentiation analysis:

    • Transport specificity assays: Determine substrate ranges for each aquaporin using heterologous expression systems. High-throughput yeast-based functional screens have identified different transport capabilities across aquaporin subfamilies .

    • Structure-function analysis: Use AlphaFold protein models to identify structural differences that may confer functional specialization .

    • Regulatory element analysis: Compare promoter regions to identify differences in stress-responsive elements that may indicate specialized roles .

  • Evolutionary analysis:

    • Phylogenetic distribution: Analyze conservation patterns across species.

    • Selection pressure analysis: Calculate dN/dS ratios to identify aquaporins under positive selection, suggesting acquisition of new functions.

    • Synteny analysis: Examine genomic context for insights into evolutionary history and potential specialized roles.

  • Integrative approaches:

    • Network analysis: Place aquaporins in the context of larger regulatory networks.

    • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data to discern functional roles.

By combining these approaches, researchers can move beyond simple gene-by-gene analysis to understand the complex interplay and specialized functions within the aquaporin family. This has successfully revealed that different TIP isoforms likely have distinct roles during drought stress adaptation, despite their structural similarities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.