Recombinant Nicotiana tabacum Probable aquaporin TIP-type RB7-5A

Shipped with Ice Packs
In Stock

Description

A. Enhanced Recombinant Protein Expression

The RB7 matrix attachment region (MAR) from Nicotiana tabacum is widely used to stabilize transgene expression. Studies show that inserting the Rb7 MAR downstream of target genes in plant vectors:

  • Increases protein yield by 3.4-fold (e.g., rituximab production in N. benthamiana) .

  • Reduces cellular necrosis by 40–60% during Agrobacterium-mediated transformation .

B. Functional Insights into Aquaporin Dynamics

  • Water Transport: RB7-5A exhibits selective permeability to water molecules, confirmed via yeast functional screens .

  • Stress Responses: Overexpression in tobacco correlates with improved drought tolerance, likely via vacuolar water retention .

Challenges in Production

Genetic instability during Agrobacterium tumefaciens-mediated delivery remains a hurdle. For example:

  • Tn3 transposons from A. tumefaciens Ti plasmids can disrupt RB7-5A expression cassettes, requiring SAR (scaffold attachment region) insulators for stability .

Future Research Directions

  • Structure-Function Studies: AlphaFold-predicted models suggest pore size variations in RB7-5A compared to other TIPs, warranting cryo-EM validation .

  • Agricultural Biotechnology: Engineering RB7-5A variants for enhanced water-use efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please let us know, and we will prioritize its development.
Synonyms
Probable aquaporin TIP-type RB7-5A; RT-TIP; TobRB7; Tonoplast intrinsic protein, root-specific RB7-5A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Protein Sequence
MVRIAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGLQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLAGFIYGDVFIGCHTPLPTSEDYA
Uniprot No.

Target Background

Function
This protein serves as a channel protein in the tonoplast. These proteins may facilitate the diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm.
Database Links

KEGG: nta:107817944

UniGene: Nta.7391

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Roots.

Q&A

How does TIP-type RB7-5A compare with other aquaporin subfamilies in plants?

Aquaporins in plants are divided into five major subfamilies: PIPs (Plasma membrane Intrinsic Proteins), TIPs (Tonoplast Intrinsic Proteins), NIPs (Nodulin26-like Intrinsic Proteins), SIPs (Small basic Intrinsic Proteins), and XIPs (X Intrinsic Proteins). As a TIP-family member, RB7-5A shares structural homology with other plant aquaporins but has distinct features that characterize its function and localization .

Different plant species contain varying numbers of aquaporin genes, with 55 identified in Populus trichocarpa, 33 in Zea mays, and multiple isoforms isolated from species including Triticum aestivum L., Nicotiana tabacum L., and Pisum sativum L. . Comparative sequence analysis reveals both conserved regions essential for water transport and variable regions that likely contribute to substrate specificity and regulatory properties specific to each aquaporin type.

What are the optimal conditions for expressing and purifying recombinant TIP-type RB7-5A?

For optimal expression and purification of recombinant Nicotiana tabacum Probable aquaporin TIP-type RB7-5A, researchers should implement the following protocol:

Expression Systems:

  • Bacterial systems (E. coli strains optimized for membrane proteins)

  • Yeast expression systems (P. pastoris or S. cerevisiae)

  • Plant-based transient expression systems

Purification Protocol:

  • Cell lysis using detergent-based methods suitable for membrane proteins

  • Affinity chromatography utilizing appropriate tags for initial purification

  • Size exclusion chromatography for further purification and to ensure protein homogeneity

Storage Conditions:
The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freezing and thawing should be avoided to maintain protein integrity. For working aliquots, storage at 4°C is suitable for up to one week .

What functional assays can be employed to characterize water transport activity of purified TIP-type RB7-5A?

Several complementary approaches can be used to characterize the water transport function of TIP-type RB7-5A:

Proteoliposome Water Transport Assays:

  • Reconstitute purified protein into liposomes of defined composition

  • Measure water flux using stopped-flow spectrophotometry or light scattering

  • Calculate osmotic water permeability coefficients (Pf) from the kinetics of vesicle volume changes

Heterologous Expression Systems:

  • Express the protein in Xenopus oocytes and measure cell swelling in hypotonic solutions

  • Use yeast mutants deficient in endogenous aquaporins for complementation studies

Fluorescence-Based Assays:

  • Incorporate pH-sensitive or other responsive fluorescent probes into vesicles

  • Monitor transport-induced changes in fluorescence intensity or spectra

Each method offers distinct advantages, and combining multiple approaches provides more robust functional characterization.

How can CRISPR/Cas9 technology be applied to study TIP-type RB7-5A function in Nicotiana tabacum?

CRISPR/Cas9 genome editing provides powerful tools for functional studies of TIP-type RB7-5A:

Design Considerations:

  • Nicotiana tabacum is an allotetraploid resulting from hybridization between N. sylvestris and N. tomentosiformis, necessitating targeting multiple gene copies

  • Design sgRNAs targeting conserved regions of all TIP-type RB7-5A alleles

  • Use multiplex CRISPR/Cas9 constructs to simultaneously target all gene copies

Implementation Strategy:
Drawing from successful CRISPR/Cas9 editing of N. tabacum genes, researchers should:

  • Design sgRNAs targeting exonic regions with high conservation across all alleles

  • Develop constructs similar to those used for glycosyltransferase knockouts in N. tabacum

  • Implement Agrobacterium-mediated transformation of tobacco plants

  • Screen transformants using molecular techniques to confirm editing of all targeted sites

Validation Approach:

  • Sequence analysis to confirm mutations at the DNA level

  • RT-PCR and Western blotting to verify absence of transcripts and protein

  • Phenotypic analysis focusing on water relations, stress responses, and cellular water homeostasis

What strategies can be employed to analyze post-translational modifications of TIP-type RB7-5A?

Post-translational modifications (PTMs) can significantly impact aquaporin function and regulation. To study PTMs of TIP-type RB7-5A:

Analytical Methods:

  • Mass Spectrometry (MS):

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive PTM mapping

    • Targeted MS approaches for specific modifications of interest

  • Biochemical Approaches:

    • Phospho-specific antibodies for detecting phosphorylation states

    • Pro-Q Diamond staining for phosphorylation detection

    • Glycoprotein-specific staining methods for glycosylation

Engineering Approaches:

  • Site-directed mutagenesis of potential modification sites (e.g., phospho-null or phosphomimetic mutations)

  • Generation of constructs with tag fusion proteins for pulldown assays

  • Utilizing expertise from N-glycosylation pathway engineering in tobacco to study potential glycosylation

Functional Correlation:
Integrate PTM identification with functional assays to establish relationships between specific modifications and protein activity, localization, or stability.

How does the expression pattern of TIP-type RB7-5A vary across different tissues and developmental stages?

Understanding the spatiotemporal expression pattern of TIP-type RB7-5A provides insights into its physiological roles:

Experimental Approaches:

  • Quantitative RT-PCR analysis across tissues, developmental stages, and stress conditions

  • RNA-Seq for global expression profiling compared to other aquaporin family members

  • Promoter-reporter fusion studies to visualize expression patterns in planta

  • Immunolocalization using specific antibodies

Methodological Considerations:

  • Include multiple reference genes for normalization in qRT-PCR studies

  • Design primers specific to TIP-type RB7-5A to avoid cross-amplification of related aquaporins

  • Use multiple biological and technical replicates to ensure reproducibility

  • Implement controls to validate antibody specificity in immunolocalization experiments

What experimental approaches can elucidate the role of TIP-type RB7-5A in plant stress responses?

Plant aquaporins play crucial roles in responses to various environmental stresses:

Stress Response Analysis Protocol:

  • Subject wild-type and TIP-type RB7-5A knockout/overexpression plants to controlled stress conditions:

    • Drought (controlled soil water deficit or polyethylene glycol treatment)

    • Salt stress (NaCl application)

    • Temperature stress (heat or cold exposure)

    • Heavy metal stress

  • Measure physiological parameters:

    • Water content and potential

    • Stomatal conductance

    • Photosynthetic efficiency

    • Growth parameters

    • Stress-responsive metabolite accumulation

  • Analyze molecular responses:

    • Gene expression changes using RT-qPCR or RNA-Seq

    • Protein abundance and localization under stress conditions

    • Post-translational modification status in response to stress stimuli

  • Cellular water transport assessment:

    • Protoplast swelling/shrinking assays

    • Pressure probe measurements

    • Hydraulic conductivity measurements

What structural features determine the specificity and selectivity of TIP-type RB7-5A?

Understanding the structural determinants of aquaporin specificity requires detailed analysis:

Key Structural Elements:

  • NPA motifs: Conservative substitutions in these motifs can alter water selectivity

  • Aromatic/Arginine (ar/R) selectivity filter: Determines pore size and substrate specificity

  • Loop regions: Contribute to gating mechanisms and regulation

  • Terminal domains: Often involved in protein-protein interactions and regulatory mechanisms

Experimental Approaches:

  • Site-directed mutagenesis of key residues followed by functional assays

  • Homology modeling based on crystallized aquaporin structures

  • Advanced structural biology techniques (X-ray crystallography, cryo-EM)

  • Molecular dynamics simulations to study water permeation mechanisms

The amino acid sequence provided in search result can be analyzed to identify these key structural features through comparative analysis with well-characterized aquaporins.

What protein-protein interactions are critical for TIP-type RB7-5A function and regulation?

Aquaporins often function within protein complexes and are regulated through interactions with other proteins:

Potential Interaction Partners:

  • Other aquaporin monomers (homotetramer formation)

  • Regulatory kinases and phosphatases

  • Trafficking and targeting proteins

  • Cytoskeletal components

Methodological Approaches:

  • Co-immunoprecipitation studies:

    • Using antibodies against TIP-type RB7-5A to pull down interaction partners

    • Similar to approaches used in other protein interaction studies

  • Yeast two-hybrid screening:

    • Using TIP-type RB7-5A as bait to identify potential interactors

    • Validate interactions with direct binding assays

  • Split-fluorescent protein complementation:

    • In planta visualization of protein-protein interactions

    • Real-time monitoring of dynamic interactions

  • Mass spectrometry-based interactomics:

    • Identification of protein complexes containing TIP-type RB7-5A

    • Quantitative analysis of interaction dynamics under different conditions

How has TIP-type RB7-5A evolved compared to aquaporins in other plant species?

Evolutionary analysis provides insights into functional conservation and specialization:

Comparative Genomic Analysis Protocol:

  • Collect TIP subfamily sequences from diverse plant species

  • Perform multiple sequence alignment to identify conserved and variable regions

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate selection pressure (dN/dS ratios) across different protein regions

  • Analyze synteny to identify true orthologous relationships

Evolutionary Patterns:
Plant aquaporins have undergone significant diversification, with varying numbers across species: 35 in Arabidopsis thaliana, 33 in Zea mays, 55 in Populus trichocarpa, and 71 in cotton . This diversity reflects genome duplication events and subsequent functional specialization.

Interpretation Framework:

  • Highly conserved residues likely perform essential functions

  • Residues under positive selection may indicate adaptation to specific environmental conditions

  • Lineage-specific expansions may represent functional diversification

What methodological approaches can resolve contradictory data in aquaporin functional studies?

Resolving contradictions in functional data requires systematic investigation:

Sources of Contradictions:

  • Differences in experimental systems (heterologous vs. in planta)

  • Variations in assay conditions (pH, temperature, membrane composition)

  • Genetic background effects in knockout/overexpression studies

  • Compensatory mechanisms by other aquaporins

Resolution Strategy:

  • Standardize experimental conditions across studies

  • Employ multiple complementary techniques to verify findings

  • Use genetic approaches that minimize compensatory effects:

    • Inducible expression/knockdown systems

    • Tissue-specific manipulations

    • Multiple aquaporin knockouts

  • Context-dependent analysis:

    • Consider developmental stage-specific effects

    • Evaluate environmental condition influences

    • Assess tissue-specific functions

  • Meta-analysis approach:

    • Systematically analyze methodologies across studies

    • Identify patterns in contradictory results

    • Design experiments specifically to address contradictions

How can TIP-type RB7-5A be utilized for improving plant stress tolerance?

Aquaporins represent promising targets for enhancing crop stress resilience:

Engineering Approaches:

  • Precise expression modulation:

    • Stress-inducible promoters to control expression timing

    • Tissue-specific promoters for targeted enhancement

    • CRISPR/Cas9-based transcriptional regulation

  • Protein engineering strategies:

    • Modify gating regions to enhance water transport under stress

    • Alter regulatory domains to optimize stress-responsive behavior

    • Engineer post-translational modification sites for improved regulation

Experimental Design for Validation:

  • Generate transgenic plants with modified TIP-type RB7-5A expression

  • Characterize molecular and physiological traits under controlled conditions

  • Evaluate stress response in growth chamber and greenhouse trials

  • Assess field performance under multiple stress scenarios

Methodological Considerations:

  • Include appropriate controls (wild-type and empty vector)

  • Perform detailed phenotypic characterization

  • Evaluate potential unintended consequences of genetic modifications

  • Consider interactions with other aquaporins and water transport systems

What technical challenges exist in crystallizing membrane proteins like TIP-type RB7-5A for structural studies?

Obtaining high-resolution structures of membrane proteins presents significant challenges:

Critical Challenges and Solutions:

  • Protein Expression and Purification:

    • Challenge: Low expression yields and protein instability

    • Solutions:

      • Optimize expression systems (bacterial, yeast, insect cells)

      • Use fusion tags to enhance solubility and stability

      • Screen multiple detergents for optimal extraction

  • Protein Stability:

    • Challenge: Maintaining native conformation outside the membrane

    • Solutions:

      • Utilize lipid cubic phase crystallization

      • Screen detergent and lipid combinations

      • Include stabilizing additives in purification buffers

  • Crystal Formation:

    • Challenge: Obtaining well-ordered crystals suitable for diffraction

    • Solutions:

      • Screen extensive crystallization conditions

      • Use antibody fragments to provide crystal contacts

      • Consider protein engineering to remove flexible regions

  • Alternative Approaches:

    • Cryo-electron microscopy for structure determination without crystallization

    • NMR spectroscopy for dynamic structural information

    • Computational modeling based on homologous structures

Table 1: Comparison of Structural Determination Methods for Membrane Proteins

MethodResolution RangeSample RequirementsAdvantagesLimitations
X-ray Crystallography1.5-3.0 ÅWell-ordered crystalsHigh resolutionDifficult crystallization
Cryo-EM2.5-4.0 ÅPurified protein (50-100 μg)No crystals neededLower resolution for small proteins
NMR SpectroscopyN/A (atomic)Isotope-labeled proteinDynamic informationSize limitation (~50 kDa)
Molecular ModelingVariableHomologous structuresNo experimental sampleAccuracy depends on templates

What quality control methods are essential when working with recombinant TIP-type RB7-5A?

Ensuring protein quality is critical for reliable experimental outcomes:

Quality Control Protocol:

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining

    • Western blotting with specific antibodies

    • Mass spectrometry for contamination identification

  • Structural Integrity:

    • Circular dichroism to verify secondary structure

    • Tryptophan fluorescence for tertiary structure assessment

    • Size exclusion chromatography to confirm homogeneity and absence of aggregation

  • Functional Validation:

    • Water transport assays (proteoliposome-based)

    • ATPase activity measurements to detect contaminating ATPases

    • Substrate specificity verification

  • Storage Stability:

    • Monitor protein stability over time under recommended storage conditions

    • Test functional activity after storage at -20°C with 50% glycerol

    • Evaluate effects of freeze-thaw cycles

Decision Criteria:
Establish clear acceptance criteria for each quality parameter before proceeding with experiments to ensure reproducible results.

How can researchers troubleshoot expression problems with TIP-type RB7-5A?

Membrane protein expression frequently encounters challenges that require systematic troubleshooting:

Common Issues and Solutions:

  • Low Expression Yields:

    • Optimize codon usage for expression host

    • Test different promoter strengths and induction conditions

    • Screen multiple expression hosts

    • Consider fusion partners that enhance expression

  • Protein Misfolding and Aggregation:

    • Reduce expression temperature (16-20°C)

    • Include compatible osmolytes in growth media

    • Test different detergents for solubilization

    • Use chaperone co-expression strategies

  • Proteolytic Degradation:

    • Include protease inhibitors during all purification steps

    • Use protease-deficient expression strains

    • Optimize cell lysis conditions to minimize exposure to proteases

    • Reduce time between induction and harvest

  • Purification Challenges:

    • Screen multiple affinity tags and their positions

    • Optimize buffer conditions (pH, salt, additives)

    • Consider native purification methods

    • Implement rapid purification protocols to minimize degradation

Systematic Troubleshooting Approach:

  • Change only one variable at a time

  • Document all conditions and results meticulously

  • Use small-scale tests before scaling up

  • Benchmark against successfully expressed membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.