Recombinant Nicotiana tomentosiformis ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Production

Recombinant atpI is the full-length subunit a of chloroplast ATP synthase from Nicotiana tomentosiformis, a wild tobacco species. It is synthesized in E. coli with an N-terminal His-tag for purification, spanning residues 1–247 (UniProt: Q33C50) .

SpecificationDetails
Expression HostEscherichia coli
TagN-terminal His-tag
Amino Acid Sequence Length247 residues
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
Key DomainsTransmembrane helices, proton translocation channels

Applications and Purification Strategies

Recombinant atpI is utilized for:

  • Structural Studies: Elucidating ATP synthase mechanics and proton translocation .

  • Biotechnological Engineering: Optimizing photosynthetic efficiency in crops .

Purification Protocols:

  1. Acidic Extraction: Effective for plant-produced proteins (e.g., N. benthamiana), reducing alkaloid contaminants like nicotine .

  2. Affinity Chromatography: Single-step His-tag purification achieves >90% purity .

Challenges and Future Directions

  • Stability Issues: Subunit a requires co-expression with other ATP synthase subunits for proper folding .

  • Heterologous Expression: Codon optimization and signal peptide selection enhance yields in plant hosts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: nto:3776342

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ATP synthase subunit a (atpI) in chloroplasts?

ATP synthase subunit a serves as a key component of the proton channel in the F0 sector of the chloroplast ATP synthase complex. It plays a direct and essential role in the translocation of protons across the thylakoid membrane . This proton movement is critical for harnessing the proton motive force (pmf) that drives ATP synthesis during photosynthesis. The atpI protein contributes to maintaining the structural integrity of the proton channel and facilitates the coupling of proton movement with the mechanical rotation that powers ATP production.

How is ATP synthase involved in photosynthetic energy conversion?

Chloroplast ATP synthase (cpATPase) is responsible for ATP production during photosynthesis by utilizing the electrochemical gradient of protons established across the thylakoid membrane during light-dependent reactions . This enzyme complex forms part of a finely tuned system where both ATP synthase and cytochrome b6f complex contents are strictly adjusted to meet the metabolic demand for ATP and NADPH . When ATP synthase activity is too low, lumen overacidification occurs, restricting linear electron flux and triggering photoprotective mechanisms even under low light conditions, which ultimately diminishes the quantum efficiency of CO2 fixation .

How does the structure-function relationship of atpI compare to other ATP synthase subunits?

While the ATP synthase complex consists of multiple subunits with specialized functions, atpI is specifically involved in proton channel formation. Unlike the catalytic β subunits (encoded by atpB) that can adopt different conformations to bind Mg-ADP, Mg-ATP, or remain empty during the catalytic cycle , atpI maintains a more stable conformation within the membrane-embedded F0 portion. The α subunit (AtpA) has been identified as a key regulator linking signaling to cellular redox homeostasis and ATP biosynthesis , whereas atpI focuses primarily on proton translocation rather than catalytic functions.

What expression systems are most effective for producing recombinant atpI?

The most effective expression system for recombinant Nicotiana tomentosiformis ATP synthase subunit a is an in vitro E. coli expression system . This approach allows for the production of the full-length protein with appropriate post-translational modifications. When expressing recombinant atpI, researchers typically include a purification tag, such as an N-terminal 10xHis-tag, to facilitate downstream purification processes . For membrane proteins like atpI, E. coli systems offer advantages in terms of high yield and scalability, though careful optimization of expression conditions is required to prevent protein aggregation and ensure proper folding.

What storage and handling conditions preserve recombinant atpI activity?

For optimal preservation of recombinant atpI, the protein should be stored at -20°C to -80°C, with -80°C preferred for long-term storage . The protein can be supplied in either liquid form or as a lyophilized powder. Lyophilized protein typically has a longer shelf life (approximately 12 months at -20°C/-80°C) compared to liquid form (approximately 6 months) . The recommended buffer for storage is a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability . To prevent activity loss from repeated freeze-thaw cycles, it is advisable to aliquot the protein upon receipt before storage.

How can researchers effectively assess proton channel activity of recombinant atpI?

To assess the proton channel activity of recombinant atpI, researchers can employ several complementary approaches:

  • Reconstitution in liposomes: Purified recombinant atpI can be reconstituted into liposomes with a pH-sensitive dye enclosed. Proton movement can then be monitored by changes in fluorescence.

  • Patch-clamp electrophysiology: This technique allows direct measurement of ion currents across membranes containing the reconstituted protein.

  • Proton gradient measurements: Researchers can monitor the dissipation of artificially created proton gradients across membranes containing the recombinant atpI.

  • Site-directed mutagenesis: Creating mutations in key residues suspected to be involved in proton translocation can provide insights into structure-function relationships. This approach is supported by studies of other ATP synthase components where point mutations, such as changing His-478 to Ala in SCP1 (another plant protein), were shown to inactivate enzyme function .

What controls are essential when studying recombinant atpI function?

When studying recombinant atpI function, the following controls are essential:

Control TypeDescriptionPurpose
Negative controlEmpty vector or expression system without atpIEstablishes baseline and confirms observations are due to atpI
Mutant controlMutated version of atpI (e.g., with substitutions in key functional residues)Confirms the specificity of observed activities
Positive controlWell-characterized related protein with known activityValidates experimental conditions and assay functionality
System controlMeasurements in the presence of specific inhibitorsConfirms observations are related to ATP synthase activity
Environmental controlsAssays performed under varying pH, temperature, and ionic strengthDetermines optimal conditions and physiological relevance

The inclusion of a mutant control is particularly important, as demonstrated in studies of other plant proteins where single amino acid substitutions (e.g., His-478 to Ala) were sufficient to abolish enzymatic activity .

How can researchers effectively integrate atpI into functional ATP synthase complexes for in vitro studies?

Integrating recombinant atpI into functional ATP synthase complexes for in vitro studies requires a systematic approach:

  • Co-expression systems: Express multiple ATP synthase subunits simultaneously to promote natural assembly.

  • Sequential reconstitution: Purify individual components and reconstitute them in a specific order that mimics the natural assembly process.

  • Native membrane incorporation: Use methods like dialysis or detergent removal to gradually incorporate atpI into prepared membrane vesicles containing other ATP synthase components.

  • Assembly verification: Confirm proper assembly using analytical techniques such as blue native PAGE, size exclusion chromatography, or electron microscopy.

  • Functional verification: Measure ATP synthesis activity, proton pumping, or ATP hydrolysis to confirm that the reconstituted complex is functionally active.

Research on other ATP synthase components has shown that individual subunits like AtpC (γ-subunit) can control the biogenesis of the entire ATP synthase complex, suggesting that coordinated assembly is critical for function .

How does atpI from Nicotiana tomentosiformis compare to homologs in other Nicotiana species?

The relationship between Nicotiana tomentosiformis atpI and homologs in other Nicotiana species reflects the evolutionary history of tobacco plants. Nicotiana tabacum is an amphitetraploid with two ancestors identified as Nicotiana sylvestris and Nicotiana tomentosiformis . Similar to what has been observed with other genes (e.g., NtSCP1 and NtSCP2), atpI homologs in N. tabacum likely originated from both ancestral species .

Comparative analysis can be conducted by:

  • Sequence alignment to identify conserved regions versus species-specific variations

  • Phylogenetic analysis to establish evolutionary relationships

  • Functional studies to identify potential differences in activity or regulation

Research has demonstrated that orthologous genes derived from N. sylvestris and N. tomentosiformis in amphitetraploid tobacco can be distinguished using species-specific PCR primers, a technique that could be applied to study atpI homologs across Nicotiana species .

What research approaches best capture the evolutionary adaptations of ATP synthase components in tobacco species?

To investigate evolutionary adaptations of ATP synthase components in tobacco species, researchers should consider the following approaches:

  • Comparative genomics: Analyze atpI sequences across multiple Nicotiana species to identify selection signatures and adaptation patterns.

  • Transcriptional analysis: Compare expression patterns of atpI in different species under various environmental conditions to detect regulatory differences.

  • Protein structure modeling: Develop 3D models based on sequence data to predict functional differences arising from structural variations.

  • Functional complementation studies: Express atpI from different species in a common genetic background to assess functional equivalence or divergence.

  • Environmental fitness assessments: Evaluate how different atpI variants affect plant performance under varying environmental conditions.

These approaches can reveal how ATP synthase components have evolved to meet specific ecological demands, similar to studies that have identified tissue-specific expression patterns of other genes across different Nicotiana species .

How is ATP synthase function modulated during environmental stress?

ATP synthase function is finely regulated during environmental stress to maintain energy homeostasis while supporting plant adaptation mechanisms. The adjustment of ATP synthase activity is crucial for:

  • Balancing energy production: During stress, plants must maintain appropriate ATP/NADPH ratios to support both stress responses and normal metabolism.

  • Protecting photosynthetic machinery: When ATP synthase activity is reduced below optimal levels, lumen overacidification occurs, triggering photoprotective mechanisms that reduce quantum efficiency but protect against photooxidative damage .

  • Supporting defense responses: The α-subunit of chloroplast ATP synthase (AtpA) has been identified as a key regulator linking signaling to cellular redox homeostasis and gene expression of resistance traits, modulating immunity to pathogen infection .

Research has shown that plants actively regulate ATP synthase content in response to metabolic demands, with transgenic plants having reduced ATP synthase levels showing increased proton motive force and activation of photoprotective mechanisms even under low light conditions .

What role does ATP synthase play in pathogen resistance mechanisms?

ATP synthase components, particularly the α-subunit (AtpA), have been identified as key proteins involved in plant immune responses. Research indicates that AtpA plays multifaceted roles in pathogen resistance:

  • Linking energy metabolism to defense: AtpA connects cellular energy production to defense signal transduction pathways.

  • Redox state regulation: AtpA influences cellular redox homeostasis, which is critical for both local and systemic defense responses.

  • Defense gene expression: AtpA modulates the expression of resistance genes, contributing to broad-spectrum resistance.

Experimental evidence has shown that plants with altered AtpA expression display enhanced tolerance to salinity and resistance to fungal pathogens like Cladosporium fulvum, suggesting that ATP synthase components serve as key regulators linking signaling to defense mechanisms . While these studies focused on AtpA, they suggest that other ATP synthase components, including atpI, may also contribute to integrated stress responses in plants.

How can ATP synthase manipulation be used to enhance crop resilience?

Strategic manipulation of ATP synthase components, including atpI, offers promising approaches for enhancing crop resilience through several mechanisms:

  • Fine-tuning energy metabolism: Carefully regulated expression of ATP synthase components can optimize energy balance under stress conditions without compromising growth under normal conditions.

  • Enhancing photoprotection: Moderate reduction in ATP synthase activity can increase non-photochemical quenching capacity, providing enhanced photoprotection during extreme light conditions .

  • Improving pathogen resistance: Targeted modifications of ATP synthase components that strengthen their roles in defense signaling could enhance broad-spectrum disease resistance .

What cutting-edge methodologies are advancing our understanding of atpI function?

Several advanced methodologies are significantly enhancing our understanding of atpI function:

  • Cryo-electron microscopy: Provides high-resolution structural insights into the organization of atpI within the intact ATP synthase complex.

  • CRISPR-Cas9 genome editing: Enables precise modification of atpI to study structure-function relationships in vivo.

  • Single-molecule biophysics: Allows real-time observation of proton translocation and conformational changes during ATP synthase operation.

  • Proteomics approaches: Identify interaction partners and post-translational modifications that regulate atpI function.

  • Computational molecular dynamics: Simulate proton movement through the channel and predict effects of specific amino acid substitutions.

Research on ATP synthase has benefited from combined approaches, as demonstrated in studies where genetic manipulation (antisense suppression and site-directed mutagenesis) was paired with physiological analysis to reveal how ATP synthase content affects photosynthetic electron flow and photoprotection .

How can researchers differentiate between effects of atpI manipulation and other ATP synthase components?

Differentiating between effects specific to atpI manipulation versus those caused by changes in other ATP synthase components requires a multifaceted experimental design:

  • Component-specific knockdown: Use RNA interference or antisense approaches targeting only atpI mRNA, while monitoring other ATP synthase components .

  • Complementation studies: In knockdown backgrounds, express modified versions of atpI to restore function while maintaining reduction of other components.

  • Site-directed mutagenesis: Create point mutations in atpI that affect specific functions without altering protein stability or complex assembly, similar to the approach used with the His-478 to Ala mutation in other proteins .

  • Protein-protein interaction analysis: Use techniques like proximity labeling or crosslinking to identify specific interactions disrupted by atpI modifications.

  • Comprehensive protein quantification: Employ absolute quantification methods to measure stoichiometric changes in all ATP synthase components following atpI manipulation.

Research has demonstrated that the loss of essential ATP synthase subunits often leads to destabilization of the entire complex, as observed with AtpC knockout in Arabidopsis . Therefore, careful protein quantification is critical when interpreting the effects of targeted manipulations.

How can researchers overcome solubility and stability issues when working with recombinant atpI?

Working with membrane proteins like atpI presents significant challenges for solubility and stability. Researchers can employ the following strategies to overcome these issues:

  • Optimized expression conditions: Reduce expression temperature (e.g., 16-20°C) and use specialized E. coli strains designed for membrane protein expression.

  • Appropriate detergent selection: Screen multiple detergents (e.g., DDM, LMNG, or digitonin) to identify those that effectively solubilize atpI while maintaining native structure.

  • Addition of stabilizing agents: Include compounds like trehalose (6% as used in commercial preparations) to enhance protein stability .

  • Fusion partners: Utilize solubility-enhancing fusion tags in addition to purification tags.

  • Reconstitution into nanodiscs or liposomes: Transfer purified protein into lipid environments that better mimic the native membrane.

The successful expression and purification of atpI with N-terminal 10xHis-tags demonstrates that these challenges can be overcome with appropriate methodological approaches.

What quality control measures ensure experimental reliability when studying recombinant atpI?

To ensure experimental reliability when working with recombinant atpI, researchers should implement the following quality control measures:

Quality Control MeasureMethodologyCritical Parameters
Purity assessmentSDS-PAGE and western blotting>90% purity is desirable
Identity confirmationMass spectrometry peptide analysisCoverage of key functional regions
Structural integrityCircular dichroism or limited proteolysisConfirmation of proper folding
Functional validationProton translocation assaysActivity comparable to native protein
Homogeneity analysisSize-exclusion chromatographyMonodisperse preparation without aggregates
Post-translational modification analysisMass spectrometryIdentification of modifications that affect function

Research on other proteins has shown that post-translational modifications can result in multiple bands (e.g., 57 and 65 kD) on western blots, and mass spectrometry analysis can confirm these represent the same protein with different modifications . Similar analyses should be applied to recombinant atpI preparations.

What are the most promising avenues for future research on Nicotiana tomentosiformis atpI?

Future research on Nicotiana tomentosiformis atpI should focus on several promising directions:

  • Integration with systems biology: Investigate how atpI functions within the broader context of chloroplast bioenergetics and whole-plant physiology.

  • Stress adaptation mechanisms: Explore how atpI regulation contributes to plant adaptation to environmental stresses, building on findings that ATP synthase adjustments affect photoprotection mechanisms .

  • Comparative analysis across species: Expand comparative studies to understand how atpI has evolved in different plant lineages and environmental niches.

  • Structure-guided engineering: Use structural insights to design modified versions of atpI with enhanced properties for specific research or agricultural applications.

  • Development of atpI-targeted regulators: Identify small molecules or peptides that can specifically modulate atpI function for research or applied purposes.

Approaches that combine genetic manipulation, structural biology, and physiological analysis have proven valuable in studying other ATP synthase components and should be equally productive for advancing our understanding of atpI.

How might interdisciplinary approaches enhance our understanding of ATP synthase function in photosynthesis?

Interdisciplinary approaches can significantly enhance our understanding of ATP synthase function in photosynthesis by integrating perspectives and methodologies from multiple fields:

  • Biophysics + Molecular Biology: Combining single-molecule techniques with genetic manipulation to correlate structural dynamics with functional outcomes.

  • Computational Biology + Biochemistry: Using molecular simulations informed by biochemical data to predict and test mechanisms of proton translocation.

  • Systems Biology + Plant Physiology: Integrating ATP synthase function into models of whole-plant energy metabolism and stress responses.

  • Synthetic Biology + Structural Biology: Designing minimal ATP synthase systems to test fundamental hypotheses about structure-function relationships.

  • Agricultural Science + Molecular Genetics: Translating fundamental insights into targeted modifications that enhance crop productivity under challenging conditions.

Research has already demonstrated the value of integrated approaches, showing how ATP synthase content affects photosynthetic electron flow, photoprotection, and ultimately plant growth and development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.