Recombinant Nicotiana tomentosiformis Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKF IELEELLFLDEMVKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIIL SGYSILGNENLAILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHSDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: nto:3776314

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the function and location of CemA in Nicotiana tomentosiformis?

CemA is a chloroplast-encoded protein found in the inner envelope membrane (IEM) of chloroplasts in Nicotiana tomentosiformis. It is inserted into the IEM from the stroma side of the chloroplast . While its precise function in N. tomentosiformis has not been fully characterized, studies in other photosynthetic organisms suggest that CemA is involved in inorganic carbon transport processes. CemA is part of the chloroplast genome rather than being encoded in the nuclear genome, which has implications for its expression regulation and evolutionary history .

How is the cemA gene organized within the chloroplast genome?

In photosynthetic organisms like Chlamydomonas reinhardtii, cemA is part of the atpA gene cluster, which includes the atpA, psbI, cemA, and atpH genes . Notably, cemA lacks its own promoter and is transcribed as part of polycistronic mRNAs (di-, tri-, or tetracistronic transcripts) . This organization suggests that cemA expression is regulated post-transcriptionally rather than at the transcriptional level. In Nicotiana species, the gene arrangement may differ but likely follows similar principles of organization within operons of functionally related or unrelated genes.

What evolutionary insights can be gained from studying cemA in Nicotiana tomentosiformis?

Nicotiana tomentosiformis is one of the ancestral species of Nicotiana tabacum (tobacco) and contains multiple cellular T-DNA sequences (cT-DNAs) acquired through horizontal gene transfer from Agrobacterium species . While cemA itself is a chloroplast gene and not directly related to these T-DNA insertions, studying its sequence conservation and evolution in N. tomentosiformis can provide insights into chloroplast genome stability during speciation events. The genome of N. tomentosiformis shows evidence of multiple sequential insertions of cT-DNAs during the evolution of the genus Nicotiana , which provides context for understanding the evolutionary pressures on chloroplast genes like cemA.

What are the optimal systems for recombinant expression of CemA?

The recombinant expression of membrane proteins like CemA presents significant challenges due to their hydrophobic nature. Based on research with other membrane proteins, several expression systems can be considered:

  • Bacterial Expression Systems: While E. coli is commonly used for recombinant protein expression, achieving functional expression of membrane proteins requires optimization. For CemA, an experimental design approach should be employed to optimize expression conditions . Key parameters include:

    ParameterOptimal Range for Membrane ProteinsNotes
    Temperature16-25°CLower temperatures reduce inclusion body formation
    Inducer concentration0.1-0.5 mM IPTGLower concentrations favor proper folding
    Growth mediaTB or 2xYT with supplementsRich media support membrane protein synthesis
    Host strainC41(DE3), C43(DE3), or BL21(DE3)pLysSStrains tolerant to membrane protein toxicity
    Fusion tagsMBP, SUMO, or His10Enhance solubility and membrane insertion
  • Plant-Based Expression: Transient expression in Nicotiana benthamiana offers advantages for plant membrane protein production . This system allows for native-like membrane insertion and post-translational modifications.

How can researchers optimize purification protocols for CemA?

Purification of membrane proteins requires specialized approaches:

  • Membrane Isolation: Chloroplast isolation followed by envelope membrane purification is essential. This can be achieved through differential centrifugation techniques .

  • Detergent Extraction: Selection of appropriate detergents is critical for maintaining protein structure and function:

    Detergent ClassExamplesApplication
    Mild non-ionicDDM, LMNGInitial extraction from membranes
    ZwitterionicCHAPS, Fos-cholineIntermediate purification steps
    Lipid-likeDigitonin, GDNStructure preservation during final purification
  • Purification Strategy: A multi-step approach combining affinity chromatography (based on fusion tags), size exclusion chromatography, and possibly ion exchange chromatography yields the purest preparations while maintaining native conformation.

How can researchers specifically target recombinant CemA to the chloroplast inner envelope membrane?

Targeting membrane proteins to specific chloroplast compartments presents a significant challenge. Research with cyanobacterial bicarbonate transporters provides valuable insights for CemA targeting :

  • Chimeric Construct Design: Creation of fusion proteins combining:

    • Transit peptide for chloroplast import

    • IEM targeting signal sequence

    • CemA protein sequence

    • Detection tag (protein A, FLAG, or His)

  • Verification of Correct Targeting: The localization should be verified through:

    • Chloroplast isolation and fractionation into stroma, envelope, and thylakoid fractions

    • Immunoblotting with antibodies against protein tags and compartment markers

    • Protease protection assays (e.g., trypsin treatment of intact chloroplasts)

Researchers have successfully used IEM targeting signals to direct nuclear-encoded proteins specifically to the chloroplast inner envelope membrane, avoiding mislocalization to thylakoid membranes . A similar approach could be applied to recombinant CemA expression.

What techniques are effective for functional characterization of recombinant CemA?

Functional characterization requires multiple complementary approaches:

  • Liposome Reconstitution Assays: Purified CemA can be reconstituted into liposomes to assess transport activity using radiolabeled substrates or fluorescent probes.

  • Complementation Studies: Expression of recombinant CemA in cemA-deficient mutants to assess functional rescue.

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation to identify interacting partners

    • Split-ubiquitin membrane yeast two-hybrid assays

    • Crosslinking followed by mass spectrometry

  • Structural Studies:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

What are the most effective transformation methods for genetic manipulation of cemA in Nicotiana tomentosiformis?

Plastid transformation represents the most appropriate approach for manipulating cemA, as it is a chloroplast-encoded gene. The methodology should include:

  • Vector Design: Creation of vectors containing:

    • Homologous flanking regions for site-specific recombination

    • Modified cemA sequence or replacement construct

    • Selectable marker (typically spectinomycin or kanamycin resistance)

  • Confirmation of Transformation: Multiple methods should be employed:

    • PCR verification of correct insertion

    • RNA analysis to assess transcription patterns

    • Protein analysis to confirm expression

    • Phenotypic assessment to evaluate functional impact

How can researchers study the impact of cemA modifications on plant physiology?

Investigating the physiological impact of cemA modifications requires comprehensive phenotyping:

  • Photosynthetic Parameter Analysis:

    • Gas exchange measurements (CO₂ assimilation rates)

    • Chlorophyll fluorescence imaging

    • Carbon isotope discrimination analysis

  • Growth and Development Assessment:

    • Biomass accumulation measurements

    • Leaf initiation rate monitoring

    • Cell size and number analysis through microscopy

  • Stress Response Evaluation:

    • Low CO₂ challenge experiments

    • High light stress tests

    • Combined stress treatments

    MeasurementWild TypecemA-ModifiedSignificance Test
    Biomass accumulationBaselineQuantitative changeANOVA, p<0.05
    Photosynthetic rateBaselineQuantitative changet-test, p<0.05
    Cell number per leaf areaBaselineQuantitative changet-test, p<0.05

What are the common difficulties in expressing functional recombinant CemA and how can they be overcome?

Membrane protein expression faces several challenges:

  • Protein Misfolding and Aggregation:

    • Solution: Use lower induction temperatures (16-20°C) and inducer concentrations

    • Include molecular chaperones (GroEL/ES, DnaK/J) in the expression system

    • Add chemical chaperones to the growth medium (glycerol, DMSO at low concentrations)

  • Toxicity to Host Cells:

    • Solution: Use tightly regulated promoters (e.g., pBAD, T7lac)

    • Employ specialized host strains designed for toxic proteins

    • Consider cell-free expression systems for highly toxic proteins

  • Improper Membrane Insertion:

    • Solution: Include appropriate signal sequences

    • Use homologous expression systems when possible

    • Optimize detergent selection for extraction and purification

  • Low Yield:

    • Solution: Scale-up strategies including bioreactor cultivation

    • Implement experimental design approaches to optimize multiple parameters simultaneously

    • Consider alternative expression systems like Nicotiana benthamiana which can provide high biomass and protein yield

How can researchers address data inconsistencies in CemA localization studies?

When facing contradictory results regarding CemA localization:

  • Methodological Verification:

    • Employ multiple complementary techniques (e.g., fractionation, immunogold labeling, fluorescent protein fusions)

    • Include appropriate controls for each fraction (marker proteins for each compartment)

    • Quantify the distribution across compartments rigorously

  • Sample Preparation Considerations:

    • Ensure intact chloroplast isolation before fractionation

    • Use protease protection assays to distinguish between outer and inner membrane localization

    • Consider sample-specific variations (tissue type, developmental stage)

What emerging technologies could advance our understanding of CemA function?

Several cutting-edge approaches show promise for CemA research:

  • CRISPR-Cpf1 Based Chloroplast Genome Editing: This technology enables precise modification of the chloroplast genome, allowing targeted mutagenesis of cemA and regulatory elements.

  • Single-Molecule Localization Microscopy: Super-resolution techniques can visualize the precise distribution and dynamics of CemA within the chloroplast envelope membranes.

  • Cryo-Electron Tomography: This approach can reveal the native membrane environment of CemA and its association with other protein complexes.

  • Synthetic Biology Approaches: Engineering minimal systems to test CemA function in artificial chloroplast membrane mimics.

How might CemA research contribute to understanding carbon concentration mechanisms in plants?

Research on CemA can provide insights into carbon concentration mechanisms:

  • Evolutionary Context: Studying CemA across diverse photosynthetic organisms could reveal evolutionary adaptations in carbon acquisition mechanisms.

  • Integration with Engineered Carbon Concentration Mechanisms: CemA could play a role in efforts to engineer improved photosynthetic efficiency, similar to approaches using cyanobacterial bicarbonate transporters .

  • Interaction Networks: Identifying CemA-interacting proteins could uncover previously unknown components of carbon transport pathways in chloroplasts.

  • Comparative Analyses: Studying how CemA function differs between C3, C4, and CAM plants could provide insights into natural carbon concentration mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.