Recombinant Nicotiana tomentosiformis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nicotiana tomentosiformis Cytochrome b6 (petB)

Recombinant Nicotiana tomentosiformis Cytochrome b6 (petB) is a bioengineered protein derived from the plastid-encoded petB gene, which encodes the cytochrome b6 subunit of the cytochrome b6f complex in photosynthetic organisms. This complex is critical for electron transport during photosynthesis, facilitating proton translocation across thylakoid membranes and contributing to ATP synthesis . The recombinant form is produced via heterologous expression in E. coli, enabling structural and functional studies of this membrane-bound protein .

Primary Structure

The full-length recombinant protein spans residues 1–215, with a molecular weight of approximately 24–26 kDa (exact weight varies by source) . Key features include:

  • Amino Acid Sequence: MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL .

  • Post-Translational Modifications:

    • His-Tag: N-terminal fusion for purification via metal affinity chromatography .

    • Heme Binding: Contains heme c1 and heme c2, essential for redox activity .

Secondary and Tertiary Structure

Cytochrome b6 adopts a transmembrane topology with α-helical domains, stabilized by interactions with subunit IV (PetD) and other components of the b6f complex . Salt bridges between PetB (cytochrome b6) and PetD are critical for complex assembly and stability .

Expression System

Recombinant petB is expressed in E. coli under optimized conditions, with yields typically exceeding 90% purity as determined by SDS-PAGE .

ParameterValue
Expression HostE. coli
TagN-terminal His-tag
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) or 50% glycerol
Protein FormLyophilized powder
Recommended Storage-20°C or -80°C (avoid repeated freeze-thaw cycles)

Functional Validation

  • Heme Incorporation: Confirmed by UV-Vis spectroscopy (Soret peak at ~420 nm) .

  • Complex Assembly: Requires co-expression with subunit IV (PetD) and other b6f components for full activity .

Role in Photosynthesis

The cytochrome b6f complex catalyzes the transfer of electrons from plastocyanin to plastoquinone, coupled with proton translocation . In Nicotiana tomentosiformis, RNA editing efficiency at the ndhD-1 site (critical for NDH complex function) is lower than in N. tabacum (15% vs. 42%), though sufficient for NDH activity .

Phosphorylation and State Transitions

Studies in Chlamydomonas reveal that the C-terminus of PetB regulates phosphorylation of STT7 kinase, influencing light-harvesting complex II (LHCII) migration during state transitions . Truncation or elongation of PetB disrupts heme c1 binding and complex stability, blocking phosphorylation cascades .

Overexpression Studies

Overexpression of the Rieske Fe-S protein (a b6f subunit) in N. tabacum increases cytochrome b6f abundance by up to 40%, enhancing electron transport rates under dynamic light conditions .

Agricultural Biotechnology

  • Enhanced Photosynthesis: Engineering plants with stabilized cytochrome b6f complexes may improve light utilization .

  • Plastid Engineering: Insights from petB studies inform strategies to modulate electron transport in crops .

Comparative Analysis of Recombinant Proteins

SourceSpeciesAmino Acid Sequence IdentityHeme BindingApplications
Creative Biomart N. tabacumFull-length (1–215)YesStructural studies, kinase assays
GeneBioSystems N. tomentosiformisFull-length (1–215)YesELISA, antibody development
AmericanSci N. tomentosiformisFull-length (1–215)YesFunctional assays, complex assembly

Challenges and Future Directions

  • Complex Stability: Recombinant PetB requires co-expression with PetD and other subunits for functional reconstitution .

  • RNA Editing: Variations in editing machinery (e.g., CRR4 orthologs) may affect post-transcriptional modifications in N. tomentosiformis .

  • Field Applications: Translating lab-based findings (e.g., enhanced b6f abundance) into crop improvement remains a priority .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nto:3776357

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is cytochrome b6 (petB) and what is its role in photosynthesis?

Cytochrome b6, encoded by the petB gene, is one of the four major subunits that constitute the cytochrome b6f complex, which plays a crucial role in the photosynthetic electron transport chain of higher plants, green algae, and cyanobacteria. This complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis during photosynthesis .

The petB gene product corresponds to a b-type/c-type cytochrome with three haems (cytochrome b6). Its molecular weight is approximately 24 kDa, and it works in coordination with other subunits including cytochrome f (cytf, encoded by petA), subunit IV (encoded by petD), and the Rieske/Iron/sulfur protein (encoded by petC) . The cytochrome b6f complex serves as an electron transfer intermediary between photosystem II and photosystem I, making it essential for photosynthetic efficiency.

How does RNA editing affect cytochrome b6 function in Nicotiana species?

RNA editing is a post-transcriptional process in flowering plants that converts specific cytidines (C) to uridines (U) in organelle mRNAs . In the context of cytochrome b6, RNA editing plays a critical role in ensuring proper protein function. For example, in maize and tobacco, proline codons at position 204 of the petB gene are edited to leucine codons at the RNA level .

Research with Chlamydomonas reinhardtii has demonstrated that the presence of proline instead of leucine at position 204 is detrimental to photosynthesis. When a proline codon was introduced in place of a leucine codon at this position, the resulting strains were non-phototrophic and displayed blocked photosynthetic electron transfer due to a lack of cytochrome b6f activity . This occurs because the proline residue disrupts the assembly of cytochrome b6f complexes, specifically at the level of assembly of apocytochrome b6 with the bh heme . This research underscores the critical importance of correct RNA editing for proper cytochrome b6 function across plant species.

How does RNA editing efficiency in N. tomentosiformis affect cytochrome b6f complex assembly?

The reduced RNA editing efficiency in N. tomentosiformis compared to other Nicotiana species raises questions about its impact on cytochrome b6f complex assembly. While the search results do not directly address petB editing in N. tomentosiformis, parallel insights can be drawn from studies of ndhD editing and cytochrome b6 mutations.

The research shows that despite the lower editing efficiency (15%) at the ndhD-1 site in N. tomentosiformis, this level is sufficient for accumulating the NDH complex and maintaining its activity . Similarly, it's plausible that even with potentially reduced editing efficiency of petB transcripts, N. tomentosiformis may maintain adequate cytochrome b6f complex assembly for photosynthetic function.

What experimental approaches are most effective for studying recombinant petB expression?

For researchers working with recombinant N. tomentosiformis cytochrome b6, several experimental approaches prove effective:

  • Heterologous Expression Systems:

    • Expression in E. coli can be used for preliminary studies but may require optimization of codon usage

    • Plant-based expression systems, such as Nicotiana benthamiana transient expression, may provide better post-translational modifications

  • Protein Detection Methods:

    • Western blot analysis using specific antibodies like the polyclonal antibody against the N-terminal region of cytochrome b6

    • Blue native PAGE (BN-PAGE) for analyzing intact protein complexes

    • Recommended antibody dilutions: 1:1000 - 1:5000 for Western blot applications

  • Functional Assessment:

    • PAM fluorometry to monitor NDH activity, which can detect transient increases in chlorophyll fluorescence after turning off actinic light

    • Spectroscopic analysis to assess heme incorporation and electron transfer capability

  • RNA Editing Analysis:

    • RT-PCR followed by direct sequencing of products to determine editing status

    • Cloning of cDNA in E. coli followed by restriction digestion (e.g., with NlaIII) to quantitatively estimate editing efficiency

    • Automated capillary-type electrophoresis (QIAxcel system) for quantitative analysis of editing efficiency

How can researchers address contradictory data regarding RNA editing in N. tomentosiformis?

Contradictory findings regarding RNA editing in N. tomentosiformis have been reported in the literature. For instance, earlier research suggested that the ndhD-1 site remained unedited in N. tomentosiformis, but subsequent studies demonstrated partial editing (15% efficiency) . To address such contradictions:

  • Methodological Considerations:

    • Use multiple complementary methods to assess editing status (direct sequencing, restriction enzyme analysis, and capillary electrophoresis)

    • Analyze a statistically significant number of clones (e.g., 100 independent clones as done in previous studies)

    • Repeat experiments with different plants to account for potential variability

  • Experimental Design for Resolution:

    • Conduct side-by-side comparison of different Nicotiana species under identical conditions

    • Implement heterologous complementation experiments similar to those performed with CRR4 genes

    • Analyze both wild populations and laboratory strains to account for genetic diversity

  • Data Integration Framework:

MethodAdvantagesLimitationsExample Application
Direct sequencing of RT-PCR productsQuick overview of editing statusLimited quantification accuracyInitial screening of editing status
Cloning and restriction analysisQuantitative assessment of editing efficiencyLabor-intensive, potential cloning biasAnalysis of 100 independent clones to determine 15% editing efficiency in N. tomentosiformis
Capillary-type electrophoresisAutomated, quantitative analysisEquipment-dependentVerification of editing efficiency in complementation studies
Functional assays (e.g., PAM fluorometry)Assesses biological significance of editingIndirect measurement of editingConfirmed NDH activity despite lower editing in N. tomentosiformis

What factors influence the stability and activity of recombinant cytochrome b6 in experimental systems?

Several factors can influence the stability and activity of recombinant cytochrome b6:

  • Proper Heme Incorporation:
    Research with cytochrome b6 mutants in Chlamydomonas reinhardtii has shown that the primary defect in proline-containing transformants was at the level of assembly of apocytochrome b6 with the bh heme . Ensuring proper heme incorporation is therefore critical for the stability and function of recombinant cytochrome b6.

  • Post-translational Modifications:
    RNA editing and other modifications may be necessary for proper protein folding and function. The study of NtomCRR4 and NsylCRR4 suggests that species-specific differences in post-translational machinery can affect protein activity or stability .

  • Expression System Selection:
    The choice of expression system can significantly impact protein stability. The complementation studies with Arabidopsis crr4-3 mutant demonstrated that heterologous expression can preserve functional differences between orthologous proteins from different species .

  • Storage and Handling Conditions:
    Based on antibody storage recommendations which may reflect protein stability requirements, recombinant cytochrome b6 likely requires controlled temperature conditions. Lyophilization may enhance long-term stability, while reconstituted protein should be stored at 4°C for short periods and aliquoted to avoid repeated freeze-thaw cycles .

  • Protein Complex Assembly:
    Since cytochrome b6 functions as part of a multi-subunit complex, its stability may depend on the presence of interaction partners. The research indicates that mutations affecting assembly with other components can lead to instability of the entire complex .

What techniques are most reliable for measuring RNA editing efficiency in petB transcripts?

Based on the research approaches used for ndhD RNA editing analysis, the following techniques can be adapted for petB transcript analysis:

  • Direct Sequencing of RT-PCR Products:
    This provides a qualitative assessment of editing status, with mixed peaks at editing sites indicating partial editing . While quick and straightforward, this method offers limited quantitative precision.

  • Cloning and Restriction Analysis:

    • Amplify cDNA including the editing site by PCR

    • Clone in E. coli (100+ independent clones recommended)

    • Analyze by digestion with appropriate restriction enzymes that differentiate between edited and unedited sequences

    • Calculate editing efficiency as the percentage of clones containing edited sequences

  • Automated Capillary-type Electrophoresis:
    The QIAxcel system enables quantitative analysis of PCR products from edited and unedited RNA. This approach provided consistent results with the cloning method in previous studies, confirming editing efficiencies of 39% and 19% for NsylCRR4 and NtomCRR4 complemented lines, respectively .

  • Quantitative RT-PCR:
    This can be used to analyze transcript levels of editing factors (though not directly measuring editing efficiency) with the following parameters:

    • Initial denaturation at 95°C for 10 min

    • 40 cycles of 95°C for 30s and 60°C for 1 min

    • Measurement of fluorescence at each cycle at 60°C

    • Analysis of threshold cycle (Ct) values from triplicate samples

How can researchers optimize heterologous expression of N. tomentosiformis cytochrome b6?

Based on the principles derived from related research, optimization strategies for heterologous expression include:

  • Codon Optimization:
    Since N. tomentosiformis may have different codon usage preferences compared to common expression hosts, codon optimization of the petB sequence for the target expression system may improve translation efficiency.

  • Inclusion of Plastid Targeting Signals:
    If expression is conducted in plant systems, including the native chloroplast transit peptide (predicted to be approximately 79 amino acids based on similar proteins) or a known efficient transit peptide may improve targeting to the correct cellular compartment.

  • Co-expression with Assembly Factors:
    Given that cytochrome b6 requires proper assembly with heme groups and other complex components, co-expression with relevant assembly factors may enhance functional protein production.

  • Expression Vector Selection:
    For plant-based expression, vectors containing appropriate promoters (e.g., 35S for nuclear expression or plastid-specific promoters for chloroplast transformation) should be selected.

  • Post-translational Modification Considerations:
    If RNA editing is required for proper cytochrome b6 function, expression in systems capable of appropriate editing or using pre-edited sequences may be necessary. The research on Chlamydomonas reinhardtii showed that this organism does not edit introduced proline codons in petB , suggesting that pre-edited sequences may be required in some expression systems.

What controls are essential for validating recombinant cytochrome b6 functionality?

To validate the functionality of recombinant N. tomentosiformis cytochrome b6, the following controls are essential:

  • Positive Controls:

    • Wild-type N. tomentosiformis cytochrome b6f complex

    • Well-characterized cytochrome b6 from model organisms (e.g., Arabidopsis thaliana)

  • Negative Controls:

    • Mutant versions with known assembly defects, such as proline substitution at position 204

    • Heme-attachment deficient mutants for comparison with assembly defects

  • Functional Assays:

    • PAM fluorometry to detect transient increases in chlorophyll fluorescence, indicating functional electron transport

    • Comparison with known non-functional variants, such as the tobacco ΔndhB mutant

  • Biochemical Validation:

    • Western blot analysis using specific antibodies against cytochrome b6

    • Blue native PAGE to assess complex assembly

    • Spectroscopic analysis to confirm proper heme incorporation

  • Complementation Tests:

    • Heterologous complementation in appropriate mutant backgrounds, similar to the approach used with CRR4 genes in Arabidopsis crr4-3 mutant

    • Assessment of restoration of photosynthetic capacity in cytochrome b6-deficient backgrounds

By implementing these controls, researchers can comprehensively validate the functionality of recombinant N. tomentosiformis cytochrome b6 and distinguish between expression, assembly, and functional defects.

How might comparative studies across Nicotiana species inform evolutionary understanding of RNA editing mechanisms?

The observed differences in RNA editing efficiency between N. tomentosiformis (15%) and other Nicotiana species like N. sylvestris (37%) and N. tabacum (42%) provide an excellent model for investigating the evolution of RNA editing mechanisms . Future research directions could include:

  • Comprehensive Editing Site Analysis:

    • Systematic comparison of all editing sites in petB and other plastid genes across Nicotiana species

    • Investigation of whether reduced editing is specific to certain sites or a genome-wide phenomenon in N. tomentosiformis

  • Trans-factor Evolution:

    • Expanded analysis of CRR4 and other PPR proteins involved in RNA editing across Nicotiana species

    • Investigation of the specific amino acid variations that influence editing efficiency

    • Exploration of whether these variations result from neutral evolution or selective pressure

  • Functional Consequences Assessment:

    • Determination of whether the lower editing efficiency in N. tomentosiformis represents an evolutionary optimization or constraint

    • Investigation of potential compensatory mechanisms that maintain photosynthetic efficiency despite reduced editing

  • Hybrid Species Analysis:

    • Further study of N. tabacum as an allotetraploid derived from N. sylvestris and N. tomentosiformis to understand inheritance patterns of editing efficiency

    • Investigation of how the editing machinery from both parent species interacts in the hybrid genome

What technological advances might enhance the study of recombinant cytochrome b6 structure-function relationships?

Emerging technologies that could advance the study of recombinant cytochrome b6 include:

  • Cryo-electron Microscopy:

    • High-resolution structural analysis of the cytochrome b6f complex incorporating recombinant N. tomentosiformis cytochrome b6

    • Comparison with structures from other species to identify critical structural differences

  • CRISPR-Cas9 Genome Editing:

    • Precise modification of petB and editing factor genes in Nicotiana species

    • Creation of edited/non-edited variants to study functional consequences in native context

  • Single-Molecule Techniques:

    • Real-time monitoring of electron transfer through individual cytochrome b6f complexes

    • Analysis of complex assembly dynamics at the single-molecule level

  • Computational Approaches:

    • Molecular dynamics simulations to predict the impact of amino acid variations resulting from differential RNA editing

    • Machine learning algorithms to identify patterns in editing site selection and efficiency across species

  • Multi-omics Integration:

    • Combined analysis of transcriptomics, proteomics, and metabolomics to understand the systemic impact of variations in cytochrome b6

    • Correlation of editing efficiency with photosynthetic performance metrics under various environmental conditions

These technological approaches, combined with the comparative framework provided by Nicotiana species, offer powerful tools for advancing our understanding of cytochrome b6 biology and the evolutionary significance of RNA editing in plant organelles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.