Recombinant Nicotiana tomentosiformis NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDFFWAFLIISILVPILAFLISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic and potentially chloroplast respiratory chains. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy in a proton gradient.
Database Links

KEGG: nto:3776349

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the physiological function of the chloroplast NDH complex?

The chloroplast NDH complex mediates cyclic electron transport and chloro-respiration . It functions in:

  • Cyclic electron flow around photosystem I: The NDH complex catalyzes the reduction of the plastoquinone pool using stromal reductant, contributing to ATP synthesis without net NADPH production

  • Chloro-respiration: The complex participates in respiratory electron transport in chloroplasts, particularly in the dark

  • Redox balancing: It helps optimize the redox state of the intersystem electron transport chain, especially under low light conditions

  • Stress response: The NDH complex plays a role in plant response to various environmental stresses, particularly low light conditions

Experimental studies with ΔndhB mutant lines have shown that while plants can grow photoautotrophically without the NDH complex under optimal conditions, its absence affects plastoquinone pool reduction at low light intensity. This suggests the complex functions in redox balancing of the intersystem, especially under suboptimal light conditions .

How are the ndhC and ndhK genes organized and expressed in the chloroplast genome?

The ndhC and ndhK genes show a unique organizational relationship:

  • Overlapping genes: The ndhC and ndhK genes partially overlap in the chloroplast genomes of tobacco and many other plants

  • Co-transcription: They are transcribed as a polycistronic mRNA (ndhC/K), often as part of a larger gene cluster (ndhC/K/J)

  • Translation initiation: The downstream ndhK mRNA possesses multiple possible AUG initiation codons. In tobacco, the major initiation site of ndhK is the third AUG, located just 4 nucleotides upstream from the ndhC stop codon

  • Stoichiometry: Despite the overlapping gene arrangement (which typically results in lower translation of the downstream cistron), the ndhC/K mRNA produces NdhC and NdhK in similar amounts to maintain the proper 1:1 stoichiometry required for NDH complex assembly

The expression of these genes involves sophisticated translational regulation mechanisms, including translational coupling and an additional termination codon-dependent pathway to ensure proper stoichiometry of the protein subunits .

What unique translational mechanisms govern ndhC/K expression?

The ndhC/K genes utilize two primary translational pathways to maintain proper stoichiometry:

  • Translational coupling (Pathway 1):

    • Translation of ndhK depends on termination of the preceding ndhC cistron

    • Mutation of the ndhC stop codon (UAG) arrests translation of the ndhK cistron

    • Frameshift of the ndhC coding strand also inhibits translation of ndhK

    • This mechanism involves ribosomes that complete ndhC translation and then reinitiate at the ndhK start codon

  • Internal initiation pathway (Pathway 2):

    • Free ribosomes enter at an internal AUG start codon (AUG 190) located in-frame in the middle of the ndhC cistron

    • These ribosomes, with formylmethionyl-tRNA fMet, translate the 3' half of the ndhC cistron

    • Upon reaching the ndhK start codon, some ribosomes continue to translate ndhK

    • This pathway produces a 57-amino-acid peptide (C-NdhC) corresponding to the sequence from the internal AUG to the ndhC stop codon

This dual mechanism ensures that NdhK and NdhC are produced in similar amounts, meeting the stoichiometric requirements of the NDH complex. Research indicates that over 2/3 of NdhK may be synthesized via Pathway 2 .

What expression systems are effective for producing recombinant ndhC protein?

Based on the available literature, effective expression systems for recombinant ndhC include:

Expression SystemProtein FormTagsPurification MethodNotes
E. coliFull-length (1-120 aa)His-tagAffinity chromatographyMost commonly used system; forms lyophilized powder
Chloroplast transformationNative proteinVarious possibleComplex isolationAllows in vivo functional studies

For heterologous expression:

  • E. coli expression system:

    • The full-length ndhC (1-120 aa) can be expressed with an N-terminal His-tag

    • The protein is typically obtained as a lyophilized powder

    • Recommended storage conditions include -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

    • For reconstitution, it is advised to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C

  • Chloroplast transformation:

    • Can be used to express ndhC in its native context

    • Requires species-specific vectors with homologous recombination regions

    • Enables functional studies of ndhC within the intact NDH complex

What techniques are most effective for analyzing ndhC function in vivo?

Several experimental approaches have proven effective for studying ndhC function:

  • Gene knockout and mutation studies:

    • Plastid transformation techniques can create knockout lines (e.g., ΔndhB, ΔndhC)

    • Blue-native gel electrophoresis can then detect alterations in NDH complex assembly

    • Phenotypic analysis under various growth conditions reveals functional significance

  • Chlorophyll fluorescence analysis:

    • Post-illumination transient increase in chlorophyll fluorescence reflects NDH activity in vivo

    • Absence of this transient in mutant lines indicates impaired NDH function

    • This non-invasive technique allows real-time monitoring of NDH activity

  • Antimycin A-insensitive, ferredoxin-dependent plastoquinone reduction assay:

    • Using ruptured chloroplasts, this biochemical assay directly measures NDH activity

    • Impairment in mutant lines confirms specific NDH function

    • This approach distinguishes NDH-mediated electron transport from other pathways

  • In vitro translation systems:

    • Chloroplast extracts can be used to study translation mechanisms of ndhC/K genes

    • Mutation analysis of the mRNA can reveal regulatory elements

    • This approach has been critical in understanding the unique translational coupling between ndhC and ndhK

How can researchers investigate the assembly and interactions of ndhC within the NDH complex?

Investigating ndhC assembly and interactions requires specialized approaches:

What approaches can be used to study the physiological significance of ndhC in different environmental conditions?

To investigate the environmental significance of ndhC function:

  • Stress response studies:

    • Comparing wild-type and ndhC mutant plants under various stress conditions

    • Particularly informative under low light, drought, or temperature stress

    • Analysis of photosynthetic parameters reveals NDH complex contribution to stress adaptation

  • Redox state analysis:

    • Measurement of the plastoquinone reduction state under different light intensities

    • Research has shown that in ΔndhB lines, the plastoquinone pool is slightly more reduced at low light intensity

    • This suggests NDH functions in redox balancing, especially under low light conditions

  • Cyclic electron flow quantification:

    • P700 oxidation-reduction kinetics can be used to estimate cyclic electron flow

    • Comparison between wild-type and mutant plants under different conditions

    • Particularly relevant under conditions where ATP demand exceeds NADPH demand

  • Metabolomic analysis:

    • Changes in metabolite profiles under different environmental conditions

    • Can reveal downstream effects of altered NDH function

    • May identify unexpected roles in cellular metabolism

How can researchers explore the evolutionary significance of the ndhC/K translational coupling mechanism?

The unique translational mechanism of ndhC/K presents interesting evolutionary questions:

  • Comparative genomic studies:

    • Analysis of ndhC/K gene arrangement across different plant species

    • Determination of conservation of overlapping gene structure

    • Identification of species-specific variations in translation initiation sites

  • Functional conservation analysis:

    • Despite possible differences in structure, research suggests chloroplast NDH mediates similar electron transport in diverse species like Marchantia and Arabidopsis

    • Comparative analysis of NDH activity across evolutionary distant species can reveal functional conservation

  • Translation efficiency measurement:

    • Ribosome profiling can measure translation efficiency across the ndhC/K transcript

    • Comparison with other overlapping genes can reveal unique features

    • Studies on translational coupling in bacteria (E. coli) have shown that ribosome recycling is not critical for translational coupling, suggesting alternative mechanisms may operate

  • Mutagenesis studies:

    • Systematic mutation of key elements in the translational coupling mechanism

    • Analysis of the effects on protein stoichiometry

    • Can reveal selective pressures maintaining this unusual translation mechanism

This evolutionary perspective helps understand why plants have maintained this complex translational mechanism throughout evolution, possibly due to the critical stoichiometric requirements of the NDH complex.

What are the optimal storage and handling conditions for recombinant ndhC protein?

Based on available product information, optimal storage and handling conditions include:

  • Storage temperature: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Default final concentration of glycerol is typically 50%

  • Stability considerations:

    • Repeated freezing and thawing is not recommended

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, maintain in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Quality control:

    • Purity should be greater than 90% as determined by SDS-PAGE

    • Functional assays should be conducted promptly after reconstitution

What analytical techniques are most informative for studying recombinant ndhC and its interactions?

Multiple analytical approaches provide valuable insights:

  • SDS-PAGE and Western blotting:

    • For basic detection and quantification of the recombinant protein

    • Can confirm expression and determine approximate molecular weight

    • Western blotting with specific antibodies confirms identity

  • Blue-native PAGE:

    • Separates intact protein complexes while preserving native protein-protein interactions

    • Has been used to detect NDH complex formation in tobacco chloroplasts (~550 kDa)

    • Can identify differences in complex formation between species

  • In vitro translation systems:

    • Chloroplast extracts can be used to study translation mechanisms

    • Native polyacrylamide gel electrophoresis and fluorescent labeling enables detection of translation products

    • Critical for understanding the unique translation mechanisms of ndhC/K

  • ELISA quantification:

    • Can precisely quantify recombinant protein levels

    • Has been used successfully with other recombinant proteins in similar systems

    • Typically includes dilution in appropriate buffer (e.g., PBS pH 7.2) and comparison to standards

  • Functional assays:

    • Antimycin A-insensitive, ferredoxin-dependent plastoquinone reduction assay

    • Measures NDH activity directly

    • Critical for confirming biological activity of recombinant protein

How are recent advances in chloroplast transformation technology impacting ndhC research?

Recent developments in chloroplast transformation are opening new research avenues:

  • Species-specific vectors:

    • Development of species-specific vectors (e.g., pCMCC for Chlorella vulgaris) with endogenous recombination regions

    • These vectors include elements like 16S–trnI (left) and trnA–23S (right) recombination regions, and the Prrn promoter

    • Enable transformation beyond model organisms like Chlamydomonas reinhardtii

  • Optimized transformation protocols:

    • Electroporation using simple carbohydrate-based buffers aids in transgene transfer to chloroplast genome

    • Selection using antibiotics like kanamycin allows isolation of transformed lines

    • PCR and Western blotting confirm presence of transgene and recombinant protein

  • Synthetic biology approaches:

    • Fully synthetic approaches facilitate straightforward assembly of species-specific vectors

    • This bypasses multiple PCR-based amplifications of flanking regions and complex cloning steps

    • Enables rapid development of new transformation systems

  • Applications beyond model organisms:

    • Expansion to commercially relevant species like Chlorella vulgaris

    • Potential for production of high-value proteins in microalgae

    • Opens new opportunities for studying NDH complex function across diverse species

What are the key remaining questions about ndhC function and regulation?

Despite significant progress, several important questions remain:

  • Regulatory mechanisms:

    • How is the expression of ndhC regulated under different environmental conditions?

    • What factors control the efficiency of the two translational pathways?

    • How is the proper stoichiometry of NDH subunits maintained during stress?

  • Functional diversity:

    • Does the role of ndhC vary across different plant species and environmental conditions?

    • Are there additional functions beyond cyclic electron flow and chloro-respiration?

    • How did the complex translational mechanisms evolve?

  • Structure-function relationships:

    • What specific domains of ndhC are critical for interaction with other NDH subunits?

    • How does the protein's structure contribute to NDH complex assembly and function?

    • What is the significance of the C-NdhC peptide produced from the internal initiation site?

  • Translation mechanisms:

    • What factors direct ribosome entry at the internal AUG start codon?

    • How widespread is this unusual translational mechanism across different genes and species?

    • What is the precise molecular mechanism by which terminating ribosomes influence downstream translation?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.