Recombinant Nicotiana tomentosiformis NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Context

The Recombinant Nicotiana tomentosiformis NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a recombinant protein derived from the chloroplast-encoded ndhE gene of Nicotiana tomentosiformis. It is a component of the NDH complex, a chloroplast NADH dehydrogenase involved in photosynthesis and redox regulation .

FeatureDetail
Gene NamendhE
Protein Length1–101 amino acids (aa)
Chloroplast LocationSmall Single Copy (SSC) region of the chloroplast genome .
Expression HostEscherichia coli (His-tagged for purification) .
Product CodeRFL6626NF

Gene and Protein Structure

  • Gene Organization: The ndhE gene is part of the chloroplast genome, specifically located in the SSC region alongside other NDH complex genes (e.g., ndhD, ndhF) .

  • Protein Features:

    • His-Tag: N-terminal fusion enhances purification via affinity chromatography .

    • Domain Composition: Belongs to the NDH complex subunit family, critical for electron transport and cyclic electron flow in chloroplasts.

Comparative Analysis with Related Subunits

The NDH complex includes multiple subunits (e.g., ndhA, ndhB, ndhD). While ndhE is not directly studied for RNA editing, other subunits like ndhD and ndhB exhibit editing in Nicotiana species:

SubunitRNA Editing SitesSpecies-Specific Features
ndhENot reportedStable gene structure in N. tomentosiformis .
ndhDPartial editing (site 1)Absent in N. sylvestris .
ndhBMultiple sites (up to 9)Higher editing frequency in N. tabacum .

Role in Chloroplast Function

The NDH complex facilitates cyclic electron flow, balancing ATP/NADPH ratios during photosynthesis. While ndhE’s precise role is less characterized, its recombinant form is used to study:

  1. Protein-Protein Interactions: Structural dynamics within the NDH complex.

  2. Evolutionary Conservation: ndhE shows high sequence identity across Nicotiana species (e.g., 97–99% with N. sylvestris and N. tabacum) .

B. Genetic Variations in Nicotiana Species

  • Chloroplast Genome Divergence: N. tomentosiformis and N. sylvestris exhibit distinct RNA editing patterns. For example, ndhD site 1 is partially edited in N. sylvestris but absent in N. tomentosiformis .

  • Polyploid Genome Dynamics: In N. tabacum (allotetraploid), ndhE retains functionality from its diploid progenitors, unlike other NDH subunits that may lose activity in polyploid genomes .

Research Applications

The recombinant ndhE protein is primarily used in:

  • Biochemical Studies: Analyzing NDH complex assembly and electron transport mechanisms.

  • Structural Biology: Crystallization or cryo-EM studies to resolve subunit interactions.

  • Comparative Genomics: Investigating chloroplast evolution in Nicotiana .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Database Links

KEGG: nto:3776351

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary origin of ndhE in Nicotiana tomentosiformis?

The ndhE subunit in N. tomentosiformis should be considered within the broader context of the species' evolutionary history. N. tomentosiformis, as an ancestral species to Nicotiana tabacum, carries multiple cellular T-DNA sequences (cT-DNAs) acquired through Agrobacterium-mediated transformation events . Deep sequencing has revealed that N. tomentosiformis contains four distinct cT-DNA inserts (designated TA, TB, TC, and TD) derived from different Agrobacterium strains, with each insert having an incomplete inverted-repeat structure . The evolutionary acquisition of these sequences appears to have occurred sequentially throughout the evolution of the Nicotiana genus . The ndhE subunit, as part of the NAD(P)H-quinone oxidoreductase complex in chloroplasts, would have evolved within this complex genomic background.

How does the structure of NAD(P)H-quinone oxidoreductase from N. tomentosiformis compare to other species?

While the specific structural details of N. tomentosiformis ndhE are not directly available from current literature, comparisons with other NAD(P)H-quinone oxidoreductases provide valuable insights. NAD(P)H-quinone oxidoreductases in eukaryotes typically function as multimeric complexes with distinct domain organizations. For example, crystal structures of human and mouse NAD(P)H:quinone oxidoreductases reveal homodimeric arrangements with each monomer containing two domains: a catalytic domain with an α/β fold similar to flavodoxin and a small C-terminal domain that forms part of the binding site for the adenosine portion of NAD . Each catalytic site is formed at the dimer interface and has three distinct regions: an FAD-binding site, an NAD(P)-binding site, and a substrate-binding pocket . Similar quinone oxidoreductases from other organisms, such as Phytophthora capsici, exhibit a bi-modular architecture with NADPH-binding grooves and substrate-binding pockets in each subunit .

What are the known functional roles of ndhE in chloroplast metabolism?

The ndhE subunit, as part of the chloroplastic NAD(P)H-quinone oxidoreductase complex, plays critical roles in electron transfer processes. By analogy with other NAD(P)H-quinone oxidoreductases, it likely participates in the transfer of electrons from NAD(P)H to quinones, which is essential for various metabolic processes . Similar enzymes have been shown to catalyze the obligatory two-electron reduction of quinones to hydroquinones, preventing the one-electron reduction of quinones that can result in oxidative cycling of deleterious radical species . In photosynthetic organisms, these reactions are important for cyclic electron flow around photosystem I, chlororespiration, and photoprotection.

What experimental design considerations are critical when studying recombinant ndhE expression and function?

When designing experiments to study recombinant ndhE from N. tomentosiformis, researchers should follow a systematic experimental design process:

  • Define clear objectives for the study, whether maximizing protein expression, characterizing enzymatic activity, or determining structure-function relationships .

  • Define the boundaries of the expression system and select factors to be studied, ensuring that all variables can be practically controlled and measured .

  • Select appropriate responses and measurement systems. For ndhE research, these might include protein yield, enzymatic activity rates, or structural parameters .

  • Choose an experimental design type based on the number of factors to be studied. Screening experiments are usually most appropriate early in research when many factors need exploration .

  • Execute experiments with meticulous attention to consistency to minimize variability .

  • Check results for issues and repeat experiments if necessary before modeling data using statistical methods to establish relationships between factors and responses .

For recombinant expression specifically, consider varying expression systems (bacterial, yeast, insect, plant), induction conditions, temperature, and purification methods. The ping-pong mechanism observed in related quinone oxidoreductases suggests that careful kinetic analysis should be employed to characterize ndhE function .

How can researchers effectively characterize the substrate specificity of recombinant ndhE?

Characterizing substrate specificity of recombinant ndhE requires a methodical approach:

  • Express and purify the recombinant protein under conditions that maintain its native structure and activity.

  • Establish baseline activity using known quinone substrates for NAD(P)H-quinone oxidoreductases.

  • Perform substrate screening with a diverse panel of quinones, varying in size and chemical properties. Evidence from other quinone oxidoreductases suggests that substrate size may be a determinant of specificity, with some enzymes preferentially catalyzing reactions with larger substrates like 9,10-phenanthrenequinone .

  • Conduct detailed kinetic analyses for promising substrates, determining parameters such as Km, Vmax, and kcat.

  • Use computational simulation and site-directed mutagenesis to identify and validate the quinone-binding channel, as has been done for other quinone oxidoreductases .

  • Compare the substrate profile of ndhE with those of homologous enzymes to identify unique specificities that might relate to its biological function in N. tomentosiformis.

What approaches are most effective for resolving the structure of recombinant ndhE?

Structural characterization of recombinant ndhE can be approached through multiple complementary techniques:

  • X-ray crystallography: This has been successfully used to determine structures of related NAD(P)H-quinone oxidoreductases at high resolution (e.g., 1.7 Å for human QR1) . Critical steps include:

    • Optimizing protein purification to achieve high homogeneity

    • Screening crystallization conditions systematically

    • Co-crystallization with substrates, cofactors, or inhibitors to capture different functional states

    • Data collection at appropriate resolution to resolve key structural features

  • Cryo-electron microscopy: Particularly useful if ndhE functions as part of a larger complex that may be difficult to crystallize.

  • Small-angle X-ray scattering (SAXS): Provides lower-resolution structural information but can be valuable for determining quaternary structure in solution.

  • Computational modeling: Homology modeling based on structures of related proteins can provide initial structural insights, especially when combined with experimental validation through mutagenesis.

When analyzing structures, researchers should pay particular attention to the three distinct regions identified in other quinone oxidoreductases: the FAD-binding site, the NAD(P)-binding site, and the substrate-binding pocket .

What expression systems are optimal for producing active recombinant N. tomentosiformis ndhE?

Selecting an appropriate expression system for recombinant ndhE requires consideration of several factors:

  • Bacterial expression (E. coli): Often the first choice due to simplicity and high yield, but may not provide appropriate post-translational modifications for plant chloroplastic proteins.

    • Consider using specialized strains designed for expression of proteins with rare codons

    • Optimize growth temperature (often lower temperatures improve folding)

    • Test various solubility-enhancing fusion tags (MBP, SUMO, etc.)

  • Yeast expression (P. pastoris, S. cerevisiae): Provides eukaryotic post-translational modifications and can be scaled up readily.

  • Plant-based expression systems: Most biologically relevant for a plant chloroplastic protein.

    • Transient expression in N. benthamiana

    • Stable transformation of A. thaliana

    • Cell-free chloroplast expression systems

  • Insect cell expression: Useful for proteins requiring complex folding.

For any system, optimizing expression conditions through Design of Experiments (DoE) approaches can significantly improve yield and activity . Key parameters to optimize include induction timing, temperature, media composition, and extraction conditions.

What purification strategies maximize yield and activity of recombinant ndhE?

Effective purification of recombinant ndhE should balance yield, purity, and preservation of activity:

  • Initial extraction: Optimize buffer composition (pH, salt concentration, reducing agents) to maintain enzyme stability and solubility.

  • Affinity chromatography:

    • His-tag purification using Ni-NTA or TALON resins

    • Consider the position of the tag (N- or C-terminal) based on structural predictions

    • Include proper controls to ensure tag placement doesn't interfere with activity

  • Additional purification steps:

    • Ion exchange chromatography based on predicted pI

    • Size exclusion chromatography to separate monomeric from multimeric forms

  • Activity preservation:

    • Include stabilizing agents such as glycerol or specific substrates

    • Consider the presence of FAD or other cofactors during purification

    • Determine optimal storage conditions (temperature, buffer composition)

  • Quality control:

    • Assess purity by SDS-PAGE and mass spectrometry

    • Verify activity using established enzyme assays

    • Check for proper folding using circular dichroism or fluorescence spectroscopy

The oligomeric state should be carefully analyzed, as related quinone oxidoreductases function as multimers (dimers or tetramers) in solution .

How can researchers effectively measure the enzymatic activity of recombinant ndhE?

Measuring enzymatic activity of ndhE requires appropriate assay design:

  • Spectrophotometric assays: Monitor NAD(P)H oxidation at 340 nm in the presence of various quinone substrates. This approach has been successful for other quinone oxidoreductases .

  • Assay optimization:

    • Determine linear range for enzyme concentration

    • Optimize substrate concentration ranges for accurate kinetic determinations

    • Control temperature and pH carefully

    • Include appropriate controls (heat-inactivated enzyme, no-substrate controls)

  • Kinetic analysis:

    • Account for the ping-pong mechanism observed in related enzymes

    • Use appropriate software for fitting kinetic data

    • Consider product inhibition effects

  • Alternative assay approaches:

    • HPLC-based detection of reaction products

    • Mass spectrometry to identify reaction intermediates

    • Fluorescence-based assays for high-throughput screening

  • In vitro vs. in organello approaches:

    • Compare activity of purified enzyme with activity in isolated chloroplasts

    • Develop assays that reflect the native environment of the protein

How should researchers interpret kinetic data from recombinant ndhE studies?

Interpreting kinetic data for ndhE requires careful consideration of enzyme mechanism and experimental conditions:

  • Mechanism considerations:

    • Similar enzymes follow a ping-pong mechanism where NAD(P)+ leaves the catalytic site after reducing flavin, allowing substrate binding at the vacated position

    • This mechanism requires specialized analysis methods for accurate parameter determination

  • Parameter determination:

    • Calculate Km and Vmax for both NAD(P)H and quinone substrates

    • Determine kcat and catalytic efficiency (kcat/Km)

    • Compare parameters across different substrates to assess specificity

  • Structural interpretation:

    • Relate kinetic differences to structural features

    • Consider the position of substrate relative to the flavin, as direct hydride transfer to specific carbon atoms may occur

  • Comparisons with related enzymes:

    • Benchmark against well-characterized homologs

    • Interpret differences in context of evolutionary divergence

  • Physiological relevance:

    • Assess whether measured kinetic parameters are consistent with estimated in vivo concentrations of substrates and cofactors

What approaches help resolve contradictory results in ndhE research?

When faced with contradictory results in ndhE research, consider the following approaches:

How can researchers effectively compare ndhE function across different Nicotiana species?

Comparative analysis of ndhE across Nicotiana species requires:

  • Phylogenetic framework:

    • Establish clear evolutionary relationships among studied species

    • Consider the history of cT-DNA insertions in different Nicotiana species

    • Account for the relative introduction times of T-DNA regions as estimated by divergence values

  • Standardized methods:

    • Use identical expression systems, purification methods, and activity assays

    • Process samples in parallel to minimize batch effects

    • Include internal controls to normalize between experiments

  • Structural comparison:

    • Align sequences to identify conserved and variable regions

    • Model structures to predict functional differences

    • Focus on catalytic sites and substrate-binding regions

  • Functional assessments:

    • Compare substrate specificities and kinetic parameters

    • Assess expression levels and tissue distribution

    • Evaluate physiological role through knockout/knockdown studies

  • Interpretation in evolutionary context:

    • Connect functional differences to ecological adaptations

    • Consider the role of horizontal gene transfer in shaping enzyme function

    • Evaluate whether differences reflect natural selection pressures

What are the main technical challenges in studying recombinant ndhE?

Researchers face several technical challenges when working with ndhE:

  • Protein stability and solubility:

    • Chloroplastic proteins often have specific folding requirements

    • Develop stabilization strategies including optimized buffers and addition of cofactors

  • Assay sensitivity and specificity:

    • Ensure assays distinguish ndhE activity from other NAD(P)H oxidoreductases

    • Develop controls to account for non-enzymatic reactions

  • Structural determination:

    • Overcome challenges in crystallizing membrane-associated proteins

    • Address potential conformational heterogeneity

  • Physiological relevance:

    • Bridge the gap between in vitro measurements and in vivo function

    • Develop methods to study the protein in its native chloroplastic environment

  • Sequence and structural homology:

    • Resolve issues of high sequence similarity with related proteins

    • Distinguish specific features of ndhE from general features of the enzyme family

How might emerging technologies advance ndhE research?

Several emerging technologies hold promise for advancing ndhE research:

  • CRISPR-Cas9 genome editing:

    • Create precise modifications to study structure-function relationships

    • Generate knockout lines to assess physiological roles

    • Implement base editing for subtle modifications

  • Cryo-electron microscopy:

    • Determine structures without crystallization

    • Capture different conformational states

    • Visualize ndhE in the context of larger complexes

  • Single-molecule techniques:

    • Observe individual enzyme molecules in action

    • Track conformational changes during catalysis

    • Measure heterogeneity in enzyme behavior

  • Protein design and engineering:

    • Improve expression and stability through rational design

    • Modify substrate specificity

    • Create biosensors based on ndhE

  • Integrative omics approaches:

    • Combine proteomics, metabolomics, and transcriptomics for systems-level understanding

    • Map protein-protein interaction networks

    • Identify regulatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.