Recombinant Nicotiana tomentosiformis NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Biological Role in Chloroplast Function

The NDH complex, including ndhG, enables two key processes:

  1. Cyclic Electron Transport (CET): Maintains ATP/NADPH balance by recycling electrons to PSI .

  2. Chlororespiration: Reduces the plastoquinone pool in darkness or under stress .

Notably, N. tomentosiformis exhibits unique RNA editing patterns in chloroplast transcripts (e.g., ndhD), which may influence NDH assembly or activity compared to N. tabacum . For example:

  • ndhD site 1 editing creates an AUG start codon in N. tabacum but is absent in N. tomentosiformis, suggesting divergent translational regulation .

  • ndhB site 8 editing is absent in N. tomentosiformis, potentially altering NDH complex functionality .

3.1. Functional Studies

  • Electron Transport Analysis: Recombinant ndhG aids in reconstituting NDH activity in vitro. The purified protein reduces plastoquinone analogs using NADPH, as demonstrated in Arabidopsis homologs .

  • Stress Response: NDH complexes mitigate oxidative stress during high light or temperature fluctuations . N. tomentosiformis ndhG variants may offer insights into adaptive electron transport mechanisms in wild tobacco species .

Future Directions

  • RNA Editing Impact: Investigating how N. tomentosiformis-specific RNA editing affects NDH complex activity under abiotic stress .

  • Biotechnological Applications: Leveraging Nicotiana transient expression systems (e.g., geminivirus vectors) for high-yield ndhG production .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) subunit 6, chloroplastic (ndhG) facilitates electron transfer from NAD(P)H:plastoquinone to quinones in the photosynthetic chain, possibly also in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction with proton translocation, thereby conserving redox energy as a proton gradient.
Database Links

KEGG: nto:3776353

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of ndhG in chloroplast metabolism?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is an essential component of the chloroplast NAD(P)H dehydrogenase (NDH) complex involved in cyclic electron flow around photosystem I. This protein participates in chlororespiration and photosynthesis by mediating electron transfer from NAD(P)H to plastoquinone in the photosynthetic electron transport chain . The NDH complex containing ndhG contributes to ATP synthesis without net NADPH production, which is particularly important under stress conditions when linear electron flow is inhibited . As a membrane-embedded subunit encoded by the plastid genome, ndhG plays a structural role in the assembly and stability of the NDH complex, ensuring efficient energy conversion during photosynthesis .

How is the ndhG gene organized within the Nicotiana plastid genome?

The ndhG gene is located in the small single copy (SSC) region of the Nicotiana plastid genome. In Nicotiana species, the SSC region typically spans approximately 18,441–18,555 bp . The gene organization follows the typical quadripartite structure of plant plastid genomes, consisting of a pair of inverted repeats (IR) regions (25,323–25,369 bp each) separated by a large single copy (LSC) region (86,510–86,716 bp) and the SSC . Comparative analyses of Nicotiana plastid genomes show that ndhG maintains a relatively conserved position within the SSC region across species . The gene context and structural borders can be visualized and analyzed using specialized tools such as IRscope, which helps researchers understand the organization and evolution of plastid genomes .

What methodologies are most effective for expressing recombinant ndhG protein?

For successful expression of recombinant Nicotiana tomentosiformis ndhG protein, a bacterial expression system using E. coli is most commonly employed . The recommended protocol includes:

  • Vector selection: Utilize a vector containing an N-terminal His-tag for efficient purification

  • Codon optimization: Optimize the ndhG sequence for E. coli expression to enhance yield

  • Expression conditions: Induce expression at lower temperatures (16-20°C) to improve protein folding

  • Purification approach: Implement immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

The expressed protein should be stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a stabilizing agent . Properly expressed protein will maintain the full-length sequence (176 amino acids for related Nicotiana tabacum ndhG), which is critical for functional studies . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week and long-term storage at -20°C/-80°C .

How does the amino acid sequence of ndhG contribute to its function?

The amino acid sequence of ndhG contains specific functional domains that enable its role in electron transport. Based on related Nicotiana species data, the protein features:

Sequence RegionStructural ElementFunctional Significance
N-terminal regionTransmembrane helicesMembrane anchoring and complex assembly
Central domainHighly conserved residuesElectron transfer pathway and cofactor binding
C-terminal regionCharged residuesInteraction with other NDH complex subunits

The sequence contains hydrophobic transmembrane segments interspersed with charged residues, enabling proper folding and integration into the thylakoid membrane . RNA editing sites significantly impact the protein structure, often converting serine to leucine and creating hydrophobic amino acids like valine, leucine, and phenylalanine, which are critical for membrane protein function and stability . The evolutionary conservation of these features across Nicotiana species highlights their functional importance in photosynthetic electron transport.

What evolutionary pressures have shaped ndhG in Nicotiana species?

Evolutionary analyses of Nicotiana plastid genomes reveal that several genes involved in photosynthesis, including ndhD and ndhF (which function alongside ndhG), have been under positive selective pressure . For ndhG specifically, a Ka/Ks ratio greater than 0.5 was observed in three Nicotiana species, indicating potential adaptive evolution . This selective pressure likely reflects adaptation to specific environmental conditions, as the NDH complex plays a crucial role in photoprotection and stress responses .

Mutation hotspot analysis within Nicotiana plastid genomes has identified 20 highly polymorphic regions that can serve as markers for phylogenetic studies . While the ndhG coding region shows moderate conservation, specific mutations may contribute to species-specific adaptations . Comparative studies reveal that the types of substitutions within Nicotiana plastid genes show similar patterns, with A/G and C/T conversions being the most common . These evolutionary patterns provide insights into how ndhG has been optimized for function in different ecological niches.

How do post-transcriptional modifications affect ndhG function?

RNA editing plays a critical role in ndhG function by modifying specific nucleotides in the transcript before translation. In Nicotiana species, C-to-U editing is predominant, particularly at the first and second positions of codons, with second-position edits occurring at higher frequency . These edits frequently convert serine codons to leucine codons, resulting in the incorporation of hydrophobic amino acids that are essential for proper protein folding and function within the membrane environment .

RNA Editing SiteCodon ChangeAmino Acid ConversionFunctional Impact
Second positionUCN → UUNSerine → LeucineEnhanced hydrophobicity
First positionCCN → UCNProline → SerineAltered protein flexibility
Second positionCAN → CUNGlutamine → LeucineIncreased membrane integration

The PREP-cp (Putative RNA Editing Predictor of Chloroplast) tool can be used to predict these editing sites with high accuracy . These modifications are essential for proper ndhG folding and integration into the NDH complex, as they often increase the hydrophobicity of key regions involved in membrane interactions or protein-protein contacts within the complex .

What are the optimal protocols for analyzing ndhG expression patterns?

For comprehensive analysis of ndhG expression patterns, researchers should implement a multi-method approach:

  • RT-qPCR analysis:

    • Design primers specific to ndhG mRNA, avoiding regions with RNA editing sites

    • Include plastid reference genes (e.g., 16S rRNA) for normalization

    • Monitor expression under various environmental conditions (light intensity, temperature, drought)

  • RNA-Seq approach:

    • Isolate total RNA from leaf tissue at different developmental stages

    • Perform rRNA depletion rather than poly(A) selection to retain plastid transcripts

    • Apply computational pipelines that account for RNA editing sites when mapping reads

  • Protein detection:

    • Generate antibodies against conserved ndhG epitopes or use His-tag antibodies for recombinant protein

    • Perform western blot analysis on isolated thylakoid membranes

    • Use chloroplast isolation protocols optimized for Nicotiana species to minimize degradation

The expression analysis should be correlated with photosynthetic parameters to establish functional relationships. Studies in Nicotiana have shown that plastid gene expression can be significantly affected by environmental conditions, making it essential to standardize growth conditions when comparing expression levels across experiments .

How can researchers effectively purify native ndhG from plant material?

Purification of native ndhG from Nicotiana tomentosiformis requires specialized techniques due to its membrane integration and participation in a multi-subunit complex:

  • Chloroplast isolation:

    • Harvest young leaves (preferably 4-6 weeks old)

    • Homogenize in isolation buffer containing sorbitol and EDTA

    • Purify chloroplasts through Percoll gradient centrifugation

  • Thylakoid membrane preparation:

    • Lyse chloroplasts with hypotonic buffer

    • Separate thylakoid membranes by centrifugation

    • Wash membranes to remove stromal contaminants

  • NDH complex isolation:

    • Solubilize membranes with mild detergents (n-dodecyl-β-D-maltoside)

    • Perform blue native PAGE to separate intact complexes

    • Confirm complex identity by mass spectrometry or western blotting

  • ndhG isolation:

    • Further dissociate the NDH complex under denaturing conditions

    • Separate subunits by SDS-PAGE

    • Identify ndhG by immunoblotting or mass spectrometry

This approach maintains the native context of ndhG and allows for analysis of its interactions within the NDH complex. For comparison studies, researchers can compare native isolation with recombinant protein characteristics to identify post-translational modifications and structural differences .

What experimental methods best elucidate ndhG protein-protein interactions?

To effectively study ndhG protein-protein interactions within the NDH complex and with other photosynthetic components, researchers should employ complementary techniques:

MethodApplicationAdvantagesLimitations
Blue Native PAGENDH complex compositionPreserves native interactionsLimited resolution of individual interactions
Co-immunoprecipitationDirect interaction partnersCan detect transient interactionsRequires specific antibodies
Split-ubiquitin assayMembrane protein interactionsIn vivo detection capabilityPossible false positives
Chemical cross-linking with MSSpatial proximityCaptures weak interactionsComplex data analysis
Förster Resonance Energy TransferDynamic interactionsReal-time monitoring possibleRequires fluorescent labeling

When implementing these methods, it's crucial to verify interactions through multiple techniques. For membrane proteins like ndhG, detergent selection is critical—use mild detergents such as digitonin or n-dodecyl-β-D-maltoside that preserve membrane protein interactions . Bioinformatic prediction tools can help identify potential interaction sites based on conserved residues in the ndhG sequence across Nicotiana species, guiding experimental design .

How do mutations in ndhG impact photosynthetic efficiency under stress conditions?

Mutations in ndhG significantly affect photosynthetic efficiency, particularly under environmental stress conditions. The NDH complex containing ndhG contributes to cyclic electron flow, which becomes especially important during stress responses . Experimental evidence shows that:

  • Under high light stress, ndhG mutations lead to decreased non-photochemical quenching (NPQ) capacity and increased susceptibility to photoinhibition

  • During drought conditions, plants with compromised ndhG function show reduced cyclic electron flow capacity and diminished ATP production

  • Temperature stress response is impaired in ndhG mutants, affecting both cold and heat tolerance

Notably, several photosynthesis-related genes in Nicotiana, including ndhD and ndhF (which operate in the same complex as ndhG), have been under positive selective pressure during evolution, indicating their adaptive importance in stress responses . Targeted mutagenesis of conserved residues in ndhG can help identify specific amino acids critical for NDH complex assembly and function, providing insights into how structural modifications affect photosynthetic performance under variable environmental conditions .

What bioinformatic approaches best predict ndhG structural dynamics?

For optimal prediction of ndhG structural dynamics, researchers should implement a multi-tool bioinformatics pipeline:

  • Primary sequence analysis:

    • Utilize multiple sequence alignments across Nicotiana species to identify conserved regions

    • Analyze substitution patterns observed in comparative genomics (A/G and C/T being most common)

    • Apply tools like DnaSP v6 to determine nucleotide diversity and evolutionary patterns

  • Secondary structure prediction:

    • Implement transmembrane helix prediction tools (TMHMM, Phobius)

    • Account for RNA editing effects on protein structure (conversion of hydrophilic to hydrophobic amino acids)

    • Validate predictions against experimental structures of homologous proteins

  • Tertiary structure modeling:

    • Apply homology modeling based on related subunits from resolved NDH complex structures

    • Refine models with molecular dynamics simulations in membrane environments

    • Evaluate structural stability through energy minimization

  • Functional domain prediction:

    • Identify binding sites for cofactors and interaction partners

    • Assess the impact of natural variation on functional sites

    • Map selective pressure data (Ka/Ks ratios) onto structural models

These approaches should be integrated with experimental validation using techniques such as site-directed mutagenesis of predicted functional residues. The effectiveness of these predictions can be enhanced by incorporating data from RNA editing sites identified through PREP-cp analysis and comparative genomic insights from the 20 highly polymorphic regions identified in Nicotiana plastid genomes .

How can CRISPR/Cas technology be applied to study ndhG function in vivo?

CRISPR/Cas technology provides powerful approaches for studying ndhG function in Nicotiana species through targeted genome editing of the plastid genome:

  • Plastid transformation strategies:

    • Design plastid-targeted CRISPR/Cas systems with specialized transit peptides

    • Optimize delivery methods for Nicotiana species (biolistic transformation preferred)

    • Select markers suitable for plastid transformation (spectinomycin resistance)

  • Guide RNA design considerations:

    • Target ndhG-specific sequences while avoiding homology with nuclear genome sequences

    • Consider plastid genome copy number when designing editing efficiency experiments

    • Include controls targeting other plastid genes with known phenotypes

  • Editing approaches:

    • Generate knockout mutations to assess loss-of-function phenotypes

    • Create point mutations in conserved residues to analyze structure-function relationships

    • Implement base editing for precise nucleotide substitutions without double-strand breaks

  • Phenotypic analysis protocol:

    • Measure photosynthetic parameters (chlorophyll fluorescence, P700 oxidation kinetics)

    • Assess plant performance under various stress conditions (high light, drought, temperature)

    • Analyze growth parameters across different developmental stages

The high copy number of plastid genomes presents a challenge for complete editing, requiring careful screening for homoplasmic mutants. This technology allows for precise examination of ndhG function in relation to the positive selection observed in photosynthesis-related genes (including ndhD and ndhF) and can provide insights into how specific mutations affect adaptation to environmental conditions.

How does ndhG sequence variation correlate with ecological adaptation in Nicotiana species?

The sequence variation in ndhG across Nicotiana species demonstrates significant correlation with ecological adaptation patterns. Comparative analyses reveal that:

  • Species adapted to high light environments show specific ndhG polymorphisms that enhance cyclic electron flow capacity

  • Drought-adapted Nicotiana species exhibit ndhG sequence modifications that improve water-use efficiency through optimized energy balance

  • Temperature adaptation is reflected in amino acid substitutions that maintain NDH complex stability under thermal stress

Evolutionary analyses of Nicotiana plastid genomes have identified that several photosynthesis-related genes, including ndhD and ndhF (which function in the same complex as ndhG), have undergone positive selection . The Ka/Ks ratio for ndhG exceeds 0.5 in three Nicotiana species, indicating adaptive evolution of this gene . This suggests that mutations in ndhG might have contributed to survival and better adaptation during the evolutionary history of tobacco species .

The biogeographical analysis of Nicotiana species shows a south-to-north range expansion and diversification pattern, with different species adapting to varied climatic regimes . This geographical distribution correlates with specific polymorphism patterns in plastid genes, including ndhG, highlighting how environmental pressures shape genetic variation in functional genes.

What are the structural differences between ndhG proteins across Solanaceae family members?

Structural comparison of ndhG proteins across the Solanaceae family reveals both conserved functional domains and species-specific variations:

Structural FeatureConservation StatusFunctional Implication
Transmembrane helicesHighly conservedEssential for membrane integration
Quinone binding siteConserved core residues with species-specific variationsFine-tuning of electron transfer rates
Subunit interaction domainsModerately variableAdaptation to partner proteins within species-specific NDH complexes
N-terminal regionVariableSpecies-specific regulation and assembly

The structural differences likely reflect adaptation to specific environmental conditions, as evidenced by the positive selection detected in photosynthesis genes across Nicotiana species . These variations may contribute to differences in NDH complex stability, electron transfer efficiency, and response to environmental stressors among Solanaceae family members.

What are the most common technical issues when working with recombinant ndhG protein?

Researchers working with recombinant Nicotiana tomentosiformis ndhG protein frequently encounter several technical challenges that require specific troubleshooting approaches:

Technical IssueCauseSolution
Low expression yieldMembrane protein toxicity to host cellsUse C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression
Protein aggregationImproper folding of hydrophobic domainsExpress at lower temperatures (16-20°C) and include mild detergents in purification buffers
Loss of activity during storageProtein denaturation during freeze-thaw cyclesStore in buffer with 50% glycerol and aliquot to avoid repeated freeze-thaw cycles
Incomplete RNA editing in expression systemsLack of plastid-specific RNA editing machineryUse codon-optimized sequences that incorporate edited nucleotides
Poor solubilityHydrophobic transmembrane domainsUse appropriate detergents (n-dodecyl-β-D-maltoside) during purification

For optimal handling of recombinant ndhG protein, lyophilized powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding 5-50% glycerol (with 50% being the default recommendation) helps maintain protein stability during long-term storage at -20°C/-80°C . Working aliquots should be stored at 4°C and used within one week to maintain protein integrity .

How can researchers accurately quantify ndhG function within the NDH complex?

  • Electron transport measurements:

    • Measure NDH-dependent post-illumination chlorophyll fluorescence rise

    • Quantify P700 re-reduction kinetics using pulse-amplitude modulation (PAM) fluorometry

    • Employ artificial electron donors and acceptors to isolate NDH-specific activity

  • Complex assembly analysis:

    • Implement blue native PAGE to assess NDH complex assembly states

    • Quantify ndhG incorporation using immunoblotting with specific antibodies

    • Apply 2D electrophoresis (BN-PAGE followed by SDS-PAGE) to analyze subunit stoichiometry

  • In vitro reconstitution assays:

    • Combine purified NDH subunits including recombinant ndhG

    • Measure reconstituted complex activity using specific electron donors

    • Perform systematic subunit omission to quantify ndhG contribution

  • Comparative mutant analysis:

    • Create site-directed mutations in conserved ndhG residues

    • Compare activity levels between wild-type and mutant proteins

    • Correlate functional impact with evolutionary conservation patterns

Activity measurements should be normalized to protein content and performed under standardized conditions. When comparing across species, researchers should account for the nucleotide diversity and selective pressure patterns observed in comparative genomic analyses . This approach allows for precise quantification of how ndhG sequence variation impacts NDH complex function and provides insights into the molecular basis of adaptation in photosynthetic electron transport.

What emerging technologies will advance ndhG functional characterization?

Several cutting-edge technologies are poised to revolutionize our understanding of ndhG function within the chloroplast NDH complex:

  • Cryo-electron microscopy:

    • High-resolution structural determination of the complete NDH complex

    • Visualization of ndhG interaction interfaces within the native complex

    • Identification of conformational changes during electron transport

  • Single-molecule techniques:

    • FRET-based approaches to monitor ndhG dynamics during electron transfer

    • Optical tweezers combined with fluorescence to assess protein-protein interaction strengths

    • Super-resolution microscopy to visualize ndhG distribution in thylakoid membranes

  • Advanced genetic tools:

    • Plastid-specific CRISPR systems for precise genome editing

    • Inducible promoter systems for temporal control of ndhG expression

    • Site-specific incorporation of non-canonical amino acids to probe function

  • Systems biology approaches:

    • Multi-omics integration connecting ndhG variation to photosynthetic performance

    • Machine learning algorithms to predict functional impacts of ndhG sequence variants

    • Network analysis incorporating evolutionary data from comparative genomics

These technologies will help address unresolved questions regarding ndhG function, potentially revealing how the positive selective pressure observed in photosynthesis-related genes translates to functional adaptations in diverse environments. The integration of structural biology with evolutionary analyses will be particularly valuable for understanding how natural variation in ndhG contributes to adaptation in different Nicotiana species.

How might knowledge of ndhG function contribute to crop improvement strategies?

Understanding ndhG function within the NDH complex has significant implications for developing stress-resistant crops through several mechanisms:

  • Enhanced photosynthetic efficiency:

    • Optimizing ndhG sequence to improve cyclic electron flow under fluctuating light conditions

    • Engineering NDH complex composition for better performance in agricultural environments

    • Fine-tuning electron transport rates to maximize carbon fixation efficiency

  • Improved stress tolerance:

    • Incorporating stress-adaptive ndhG variants from wild Nicotiana species into crops

    • Enhancing photoprotection mechanisms through optimized NDH function

    • Developing crops with improved performance under drought and temperature extremes

  • Biotechnological applications:

    • Using knowledge of positive selection in ndhG and related genes to identify adaptive variants

    • Applying plastid transformation technologies to introduce beneficial ndhG modifications

    • Developing screening methods based on NDH complex function for crop breeding programs

  • Climate change adaptation strategies:

    • Predicting how ndhG sequence variants might perform under future climate scenarios

    • Preparing germplasm resources with diverse ndhG alleles for breeding programs

    • Creating crops with improved resilience to increasingly variable environmental conditions

Research into the 20 highly polymorphic regions identified in Nicotiana plastid genomes could yield valuable markers for tracking and selecting beneficial ndhG variants. The knowledge that specific genes involved in photosynthesis have been under positive selective pressure during evolution provides a blueprint for targeted crop improvement, focusing on components like ndhG that contribute to environmental adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.