Recombinant Nicotiana tomentosiformis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Recombinant CP47 production typically involves heterologous expression in E. coli or transient systems (e.g., Nicotiana benthamiana leaves) . For N. tomentosiformis psbB, challenges include proper chlorophyll binding and membrane integration.

Production ParametersDetails
Host SystemE. coli (His-tagged fusion) , N. benthamiana (transient expression)
PurificationNi-NTA affinity chromatography for His-tagged proteins
Chlorophyll IncorporationRequires co-expression with chlorophyll biosynthesis enzymes
YieldVaries; spinach CP47 yields >90% purity via SDS-PAGE

Research Findings and Applications

Assembly Dynamics
Studies in Synechocystis and Arabidopsis reveal that CP47 assembly depends on auxiliary proteins like Pam68, which facilitates chlorophyll loading during translation . In N. tomentosiformis, low RNA editing efficiency for the ndhD-1 site (15% vs. 42% in N. tabacum) highlights potential genetic variations affecting plastid protein maturation .

Stress Response
PsbI stabilizes CP43 binding in PSII core complexes, suggesting that similar interactions may occur with CP47 . Mutant plants lacking PsbI show reduced PSII core stability under high light, underscoring the importance of accessory proteins .

Future Directions

  1. Bioengineering: Leveraging N. tomentosiformis psbB for enhanced light-harvesting efficiency in crops.

  2. RNA Editing: Investigating how low editing efficiency in N. tomentosiformis affects psbB function .

  3. Structural Studies: X-ray crystallography to resolve CP47 interactions with D1/D2.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function

A core component of the photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP synthesis.

Database Links

KEGG: nto:3776368

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CP47 chlorophyll apoprotein in Photosystem II?

CP47 is one of the integral antenna proteins of the oxygen-evolving Photosystem II (PSII) complex. It plays a crucial role in light harvesting and excitation energy transfer to the PSII reaction center. The CP47 protein binds 16 chlorophyll molecules whose electronic properties and spatial arrangement are essential for facilitating efficient energy transfer pathways . This energy transfer ultimately leads to charge separation in the reaction center, initiating the electron transfer cascade that drives oxygenic photosynthesis. Understanding CP47's structure and function is fundamental to elucidating the mechanisms of photosynthetic light harvesting.

Why is Nicotiana tomentosiformis used as a model organism for photosynthesis research?

Nicotiana tomentosiformis serves as an important model organism in photosynthesis research, particularly in comparative studies with other Nicotiana species. As one of the progenitors of Nicotiana tabacum (cultivated tobacco), N. tomentosiformis provides valuable insights into the evolution of photosynthetic machinery. Research has demonstrated that despite some differences in gene expression efficiency compared to related species, N. tomentosiformis maintains functional photosynthetic complexes, including active NAD(P)H dehydrogenase (NDH) complexes . This suggests robust conservation of core photosynthetic functions despite evolutionary divergence, making it an excellent model for studying the relationship between genetic variation and photosynthetic function.

How does the genomic structure of psbB in N. tomentosiformis compare to other Nicotiana species?

The psbB gene in N. tomentosiformis shows substantial conservation with orthologous genes in related Nicotiana species, though with distinct variations that may affect expression levels and protein functionality. While the search results don't provide specific information about intron structure in psbB, research on other genes in Nicotiana species indicates that genomic structure can vary between species. For instance, some genes in Nicotiana species lack introns that are present in their Arabidopsis orthologs . Comparative genomic analysis suggests that while coding sequences are generally well-conserved across Nicotiana species, regulatory elements and non-coding regions may exhibit more significant variation, potentially affecting expression patterns and efficiency.

What methodological approaches are most effective for expressing recombinant CP47 from N. tomentosiformis?

Expression of recombinant photosystem proteins presents significant challenges due to their complex membrane integration and cofactor binding requirements. For recombinant CP47 expression from N. tomentosiformis, researchers should consider several methodological approaches:

  • Promoter selection: Comparative studies between the enhanced 35S promoter (a tandem duplication of 327 bp sequence upstream of the core promoter with the 5' untranslated Ω leader) and the PMA4 promoter have shown different expression efficiencies for recombinant proteins in plant systems . The choice between these promoters should be based on the desired expression level and tissue specificity.

  • Signal peptide optimization: Including an appropriate signal peptide, such as the PDI signal peptide, can significantly improve targeting and integration of membrane proteins like CP47 .

  • Expression system selection: Plant-based expression systems are generally preferable for photosystem proteins due to their ability to provide the correct post-translational modifications and membrane integration machinery. Tobacco BY-2 cell cultures offer a balance between scalability and proper protein processing .

  • Purification strategy: A 6xHis-tag approach allows for efficient purification while minimizing interference with protein function, though researchers should verify that the tag doesn't affect CP47 assembly or function .

Each expression strategy should be validated through protein accumulation analysis, functionality assays, and structural integrity verification.

How do quantum mechanical calculations inform our understanding of CP47 chlorophyll excitation energies in N. tomentosiformis?

Advanced quantum mechanics/molecular mechanics (QM/MM) approaches using time-dependent density functional theory with range-separated functionals provide critical insights into the excitation energies of CP47 chlorophylls. These computational models can quantify the electrostatic effects of the protein environment on chlorophyll site energies .

Recent computational studies of cyanobacterial PSII have revealed that the ranking of site energies among the 16 chlorophyll molecules in CP47 differs from previous hypotheses, with chlorophylls B3 and B1 showing the most red-shifted absorption . While these calculations were performed on cyanobacterial CP47, similar approaches could be applied to N. tomentosiformis CP47 to:

  • Map energy transfer pathways specific to N. tomentosiformis CP47

  • Identify structural variations that might alter excitation energy profiles compared to other species

  • Predict the functional consequences of amino acid variations unique to N. tomentosiformis

Such calculations require significant computational resources but provide valuable atomic-level insights that cannot be obtained through experimental methods alone.

What are the critical factors affecting RNA editing of photosystem-related transcripts in N. tomentosiformis?

RNA editing is a crucial post-transcriptional modification in plant organelles that can significantly impact protein expression and function. In Nicotiana species, RNA editing efficiency shows species-specific variation. For instance, the ndhD-1 site is edited with only 15% efficiency in N. tomentosiformis compared to 42% in N. tabacum and 37% in N. sylvestris .

When investigating RNA editing of photosystem-related transcripts in N. tomentosiformis, researchers should consider:

  • Trans-acting factors: Variations in pentatricopeptide repeat (PPR) proteins like CRR4 can significantly affect editing efficiency. N. tomentosiformis CRR4 (NtomCRR4) shows amino acid variations compared to orthologs in other Nicotiana species, which likely contributes to reduced editing efficiency .

  • Recognition sequences: Cis-elements surrounding editing sites influence the binding of editing factors. Sequence variations in these regions between Nicotiana species may contribute to differential editing efficiencies.

  • Functional thresholds: Despite lower editing efficiency, N. tomentosiformis maintains functional photosynthetic complexes, suggesting that even partial editing can be sufficient for protein function . Similar thresholds may exist for CP47-related transcripts.

Understanding these factors is essential for accurately interpreting gene expression data and for designing effective strategies for recombinant protein expression.

What purification protocols yield the highest structural integrity for recombinant CP47 protein?

Purification of membrane proteins like CP47 while maintaining their structural integrity requires carefully optimized protocols:

Purification StageRecommended ApproachCritical Considerations
Cell disruptionGentle mechanical disruption (e.g., French press at 1,100 psi)Avoid excessive heat generation; perform under dim green light to prevent photooxidation
Membrane isolationDifferential centrifugation (10,000×g for 10 min followed by 40,000×g for 1 h)Maintain complete protease inhibitor cocktail throughout processing
Detergent solubilizationMild non-ionic detergents (n-dodecyl-β-D-maltoside at 0.5-1.0%)Optimize detergent:protein ratio; solubilize at 4°C for 30-60 min
Affinity chromatographyNi-NTA for His-tagged proteins with imidazole gradient elutionInclude 0.03% detergent in all buffers; elute with 250 mM imidazole
Size exclusionSuperose 6 column equilibrated with 20 mM HEPES pH 7.5, 100 mM NaCl, 0.03% detergentAnalyze fractions for chlorophyll absorption spectra integrity

When using His-tagged constructs, it's important to verify that the tag doesn't interfere with protein folding or function through comparative spectroscopic analyses with native protein. Researchers should also consider analyzing the pigment composition of purified recombinant CP47 to confirm proper chlorophyll incorporation, as the chlorophyll-binding properties are essential for function .

How can researchers accurately quantify RNA editing efficiency for transcripts encoding photosystem components?

Based on methodologies used for studying RNA editing in Nicotiana species, researchers can employ the following approaches to quantify editing efficiency in transcripts encoding photosystem components:

  • Direct sequencing of RT-PCR products: This approach provides a qualitative assessment of editing. The relative peak heights at the edited position in the chromatogram provide a rough estimate of editing efficiency .

  • Restriction fragment length polymorphism (RFLP) analysis: For sites where RNA editing creates or abolishes a restriction site, RFLP analysis of RT-PCR products can be used for quantification. For example, the ndhD-1 site can be analyzed by NlaIII digestion, which recognizes sequences in edited transcripts .

  • Cloning and sequencing of individual cDNA clones: This method provides the most accurate quantification. RT-PCR products are cloned, and 100 or more independent clones are analyzed to determine the percentage of edited transcripts .

  • High-throughput sequencing: For comprehensive analysis of multiple editing sites, RNA-seq data can be analyzed to quantify editing efficiency across the transcriptome.

For accurate quantification, researchers should:

  • Include controls with known editing efficiencies

  • Perform biological replicates (minimum three independent experiments)

  • Consider developmental and tissue-specific variations in editing efficiency

What spectroscopic methods are most informative for analyzing CP47 function in recombinant systems?

Several spectroscopic techniques provide complementary information about CP47 structure and function:

Spectroscopic MethodInformation ProvidedExperimental Parameters
Absorption spectroscopyChlorophyll content, protein foldingScan 350-750 nm; analyze Qy band position (660-680 nm) and relative intensities
Circular dichroismSecondary structure, pigment-protein interactionsFar-UV (190-250 nm) for protein structure; visible region (400-700 nm) for pigment-protein interactions
Fluorescence spectroscopyEnergy transfer efficiency, chlorophyll organizationExcitation at 430-440 nm; emission scan 650-800 nm; measure at 77K for higher resolution
Time-resolved fluorescenceExcitation energy transfer kineticsMeasure at picosecond to nanosecond timescales; compare decay components
Pulse amplitude modulation (PAM) fluorometryFunctional energy transfer to reaction centersMonitor transient increase in chlorophyll fluorescence after turning off actinic light

PAM fluorometry is particularly valuable for assessing the functional integration of CP47 into the photosynthetic apparatus. The presence of a transient increase in chlorophyll fluorescence after turning off actinic light illumination indicates functional coupling with other photosystem components, as demonstrated in studies of NDH complex activity in Nicotiana species .

How do amino acid variations in CP47 across Nicotiana species affect protein function and stability?

Amino acid variations in CP47 across Nicotiana species can significantly impact protein function and stability through several mechanisms:

What challenges arise when correlating in vitro and in vivo data for recombinant photosystem proteins?

Several key challenges complicate the correlation between in vitro and in vivo data for recombinant photosystem proteins:

  • Lipid environment differences: The lipid composition in recombinant expression systems may differ from native thylakoid membranes, potentially affecting protein folding, stability, and function.

  • Post-translational modification variations: The efficiency and pattern of post-translational modifications, including RNA editing, may differ between native and recombinant systems. For example, the 15% editing efficiency observed for ndhD-1 in N. tomentosiformis may not be replicated in heterologous expression systems .

  • Protein complex assembly: Photosystem proteins typically function as components of larger complexes. The availability and stoichiometry of partner proteins in recombinant systems may not match native conditions, affecting functional assessments.

  • Artifacts from protein tags: Affinity tags used for purification may interfere with protein function or protein-protein interactions, even if they don't prevent basic folding.

To address these challenges, researchers should validate recombinant protein function through multiple complementary approaches, including spectroscopic methods, activity assays, and when possible, functional complementation studies in appropriate mutant backgrounds.

How might quantum biology approaches enhance our understanding of energy transfer in recombinant CP47?

Quantum biology approaches offer powerful tools for understanding the fundamental mechanisms of energy transfer in photosynthetic complexes like CP47:

  • Quantum coherence phenomena: Advanced spectroscopic techniques such as two-dimensional electronic spectroscopy can detect quantum coherence effects that may contribute to the remarkably high efficiency of photosynthetic energy transfer. Applying these techniques to recombinant CP47 could reveal whether specific amino acid variations in N. tomentosiformis affect quantum coherence properties.

  • Quantum mechanics/molecular mechanics simulations: QM/MM approaches have already demonstrated value in mapping chlorophyll excitation energies in CP47, identifying B3 and B1 as the most red-shifted chlorophylls . Extending these approaches to comparative analysis of CP47 variants could predict how specific amino acid changes affect energy transfer pathways.

  • Quantum master equation models: These mathematical frameworks can model the quantum dynamics of energy transfer while accounting for environmental interactions. Such models could predict how specific structural features of N. tomentosiformis CP47 affect energy transfer efficiency.

By integrating quantum approaches with traditional biochemical and spectroscopic methods, researchers can develop a multi-scale understanding of how molecular structure determines energy transfer properties in photosynthetic proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.