Recombinant Nicotiana tomentosiformis Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Research Findings and Functional Insights

Studies highlight the role of recombinant psbA in structural and functional analyses:

  • Host Cell Protein (HCP) Analysis: In biopharmaceutical production, residual psbA was identified as a contaminant in plant-based systems (p-value: 0.005), underscoring the need for stringent purification protocols .

  • Photosynthetic Dysfunction: Mutant D1 isoforms (e.g., sentinel D1 in cyanobacteria) lack water-oxidation capacity, a property exploited to study PSII repair cycles .

Table 2: Comparative psbA isoforms in Nicotiana species

SpeciesUniProt IDExpression SystemKey Application
N. tomentosiformisQ33C59E. coliProtein interaction studies
N. sylvestrisQ3C1G3E. coliRedox regulation assays

Production and Purification

The recombinant protein is produced in E. coli with the following specifications :

  • Expression Vector: pET-based system with N-terminal His-tag.

  • Yield: >90% purity confirmed by SDS-PAGE.

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C.

Applications in Biotechnology

  • Photosynthesis Research: Used to dissect PSII assembly and photodamage mechanisms .

  • Biopharmaceutical Safety: Monitored as a contaminant in plant-derived therapeutics .

  • Enzyme Kinetics: Facilitates studies on herbicide-binding sites due to conserved QB-binding regions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nicotiana tomentosiformis (Tobacco)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Database Links

KEGG: nto:3776367

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Photosystem Q(B) protein (psbA) in Nicotiana tomentosiformis?

The Photosystem Q(B) protein, encoded by the psbA gene, is a critical component of Photosystem II (PSII) in the photosynthetic apparatus of Nicotiana tomentosiformis. This protein functions as the D1 protein in PSII and plays a central role in the light-driven water/plastoquinone photooxidoreductase activity. The protein contains the binding site for the exchangeable plastoquinone (QB), which accepts electrons from QA during photosynthetic electron transport . The D1 protein in Nicotiana species typically consists of approximately 344 amino acid residues, with a molecular structure optimized for electron transport and plastoquinone binding .

Comparative genomic analysis indicates that the psbA gene in N. tomentosiformis is located within the chloroplast genome, which has a total length of 155,745 bp with a GC content of 37.79% . The gene lies within coding regions that constitute approximately 109,404 bp of the chloroplast genome, while the remaining 46,341 bp comprise intergenic regions . This structural organization is consistent with other Nicotiana species, reflecting the conserved nature of this essential photosynthetic protein across evolutionary lineages.

How does the chloroplast genome organization of Nicotiana tomentosiformis affect psbA expression and function?

The chloroplast genome of Nicotiana tomentosiformis exhibits a typical quadripartite structure composed of a large single copy (LSC) region of 86,393 bp with 35.88% GC content, a small single copy (SSC) region of 18,496 bp with 31.96% GC content, and two inverted repeat (IR) regions each spanning 25,428 bp with 43.16% GC content . This genomic organization influences the expression and regulation of the psbA gene.

The position of the psbA gene within the chloroplast genome affects its transcription rate and response to environmental stimuli. The gene is typically located in the LSC region, where it can be efficiently transcribed by the chloroplast RNA polymerase machinery. The relatively low GC content in the regions surrounding psbA may influence its stability and translation efficiency, particularly under stress conditions when chloroplast function may be compromised.

Table 1: Comparative Genomic Features of psbA-containing Chloroplast Genomes in Selected Nicotiana Species

SpeciesTotal Length (bp)GC ContentLSC Length (bp)LSC GC ContentSSC Length (bp)SSC GC ContentIRs Length (bp)IRs GC Content
N. tomentosiformis155,74537.79%86,39335.88%18,49631.96%25,42843.16%
N. tabacum cv. K326156,02637.84%86,77035.93%18,57232.06%25,34243.22%
N. otophora155,91237.76%86,60935.83%18,49931.96%25,40243.15%

The genomic context of psbA influences not only its basal expression but also its responsiveness to environmental cues and developmental stages. Understanding this genomic organization provides insights into the evolutionary pressures that have shaped this critical photosynthetic gene in Nicotiana species .

What are the amino acid sequence characteristics of the psbA protein, and how do they compare across Nicotiana species?

While the exact amino acid sequence of N. tomentosiformis psbA protein is not provided in the search results, we can infer key characteristics by examining related Nicotiana species. In Nicotiana sylvestris, the Photosystem Q(B) protein consists of 344 amino acids with a sequence that includes transmembrane domains essential for anchoring within the thylakoid membrane .

The amino acid sequence of N. sylvestris psbA protein (Q3C1G3) is:
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

This sequence contains several conserved regions that are critical for function, including binding sites for cofactors and domains involved in electron transport. The protein typically contains multiple transmembrane alpha-helices that span the thylakoid membrane, positioning key functional groups to optimize electron transfer during photosynthesis.

Comparative analysis with other Nicotiana species reveals high sequence conservation, particularly in regions associated with function. For example, the sequence similarity between N. sylvestris and N. tomentosiformis psbA proteins is expected to be very high, given their close evolutionary relationship and the essential nature of this photosynthetic component .

What are the most effective expression systems for producing functional recombinant Nicotiana tomentosiformis psbA protein?

Producing functional recombinant psbA protein presents significant challenges due to its membrane-embedded nature and the presence of multiple transmembrane domains. Based on protocols established for similar proteins, E. coli-based expression systems have proven effective for producing recombinant photosystem proteins for structural and functional studies .

When expressing N. tomentosiformis psbA protein in E. coli, several considerations must be addressed:

  • Codon optimization: The chloroplast genome uses a different codon preference compared to E. coli. Codon optimization of the psbA gene sequence for E. coli expression is essential to maximize protein yield.

  • Fusion tags: N-terminal His-tags facilitate purification while minimizing interference with protein function. As demonstrated with similar proteins, the addition of a His-tag allows for effective purification using immobilized metal affinity chromatography (IMAC) .

  • Expression conditions: Expression at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) can enhance the production of properly folded protein.

  • Membrane mimetics: Incorporating membrane mimetics such as detergents or amphipols during purification helps maintain protein stability and function.

For more complex functional studies, alternative expression systems such as cell-free translation systems or chloroplast transformation in model organisms may offer advantages for producing functional protein with proper cofactor incorporation and post-translational modifications.

How can researchers effectively assess the energetics and redox properties of the QB site in recombinant psbA protein?

The QB site in Photosystem II plays a crucial role in electron transport, and understanding its energetics provides insights into photosynthetic efficiency. Several methodological approaches can be employed to characterize the redox properties of the QB site in recombinant psbA protein:

  • Electrochemical methods: Cyclic voltammetry and differential pulse voltammetry can be used to determine the midpoint potentials (Em) of the QB/QB- and QB-/QBH2 redox couples. These measurements provide fundamental thermodynamic parameters that govern electron transfer kinetics .

  • EPR spectroscopy: Electron paramagnetic resonance can detect and characterize the semiquinone radical intermediates formed during electron transfer, providing information about the electronic structure of the QB site.

  • FTIR difference spectroscopy: This technique can identify specific interactions between the quinone and protein environment by monitoring changes in vibrational features upon reduction or protonation.

  • Binding studies: Isothermal titration calorimetry (ITC) or fluorescence quenching can be used to determine binding affinities of different quinones to the QB site, revealing structure-function relationships.

The energetics of QB in Photosystem II are comparable to those in homologous bacterial reaction centers, with the redox behavior being influenced by protein-quinone interactions and the local electrostatic environment . Researchers should consider these similarities when designing experiments and interpreting results from studies with recombinant N. tomentosiformis psbA protein.

What methodologies are most effective for studying psbA mutations and their impact on photosynthetic efficiency?

Studying the effects of psbA mutations on photosynthetic efficiency requires a multifaceted approach that combines molecular biology techniques with biophysical and biochemical analyses:

When interpreting results from mutation studies, it is important to consider both direct effects on electron transport and indirect effects on protein stability, assembly, or interaction with other photosystem components. Comparative analysis with known mutations in other species can provide valuable context for understanding the significance of observed phenotypes .

What are the optimal conditions for purification and reconstitution of recombinant Nicotiana tomentosiformis psbA protein?

Purification and reconstitution of recombinant psbA protein require careful attention to maintain protein stability and function. Based on protocols for similar membrane proteins, the following steps are recommended:

  • Initial purification: After expression in E. coli, cells should be lysed using physical methods (such as sonication or French press) in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and appropriate protease inhibitors. Membrane fraction isolation via ultracentrifugation (100,000 × g for 1 hour) concentrates the target protein .

  • Solubilization: Gentle detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration effectively solubilize membrane proteins while preserving structure.

  • Affinity chromatography: For His-tagged recombinant protein, IMAC using Ni-NTA resin with an imidazole gradient (20-300 mM) effectively removes contaminants while retaining the target protein .

  • Size exclusion chromatography: A final purification step using a Superdex 200 column removes aggregates and ensures homogeneity.

  • Reconstitution: For functional studies, reconstitution into liposomes or nanodiscs provides a native-like membrane environment. A mixture of phosphatidylcholine and phosphatidylglycerol (7:3 ratio) typically mimics the thylakoid membrane composition.

  • Storage: The purified protein should be stored in a buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.03% DDM, and 6% trehalose at -80°C to maintain stability . Aliquoting prevents damage from freeze-thaw cycles.

The purity should be verified using SDS-PAGE (expected purity >90%) and Western blotting with antibodies specific to the D1 protein or the affinity tag .

How can researchers effectively assess the structural integrity and functional activity of purified recombinant psbA protein?

Assessing both structural integrity and functional activity is essential for validating recombinant psbA protein quality. Several complementary approaches can be employed:

  • Circular dichroism (CD) spectroscopy: Far-UV CD spectra (190-260 nm) provide information about secondary structure content, while near-UV CD (260-320 nm) assesses tertiary structure. Properly folded psbA protein should show characteristic spectra with negative peaks at 208 and 222 nm, indicating alpha-helical content.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence and its quenching patterns can indicate proper folding of the protein and binding of cofactors.

  • Pigment binding: Absorption spectroscopy can verify the binding of chlorophyll and other cofactors essential for function. The ratio of absorbance at specific wavelengths (e.g., A435/A280) provides a measure of pigment incorporation.

  • Electron transfer assays: Using artificial electron donors and acceptors, electron transfer activity can be assessed spectrophotometrically by monitoring the reduction of artificial electron acceptors such as dichlorophenolindophenol (DCIP).

  • Quinone binding assays: Isothermal titration calorimetry or fluorescence quenching assays can confirm the ability of the recombinant protein to bind plastoquinone analogues, a critical functional property.

  • Reconstitution assays: For comprehensive functional assessment, the recombinant protein can be reconstituted with other PSII components to measure composite activities such as oxygen evolution or fluorescence induction.

These methods collectively provide a robust assessment of whether the recombinant protein maintains both structural integrity and key functional characteristics necessary for physiological activity.

What are the most effective techniques for studying protein-protein interactions involving psbA in photosystem II complex assembly?

Understanding protein-protein interactions is crucial for elucidating the assembly and function of Photosystem II. Several techniques have proven effective for studying these interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against psbA or interacting partners, protein complexes can be isolated and analyzed to identify physiologically relevant interactions.

  • Bimolecular fluorescence complementation (BiFC): By fusing potential interacting partners with complementary fragments of a fluorescent protein, interactions can be visualized in vivo when the fragments come together to reconstitute fluorescence.

  • Förster resonance energy transfer (FRET): Using donor-acceptor fluorophore pairs attached to potential interacting proteins allows detection of nanometer-scale proximity between proteins.

  • Surface plasmon resonance (SPR): This label-free technique can quantitatively measure binding kinetics and affinities between psbA and other PSII components in real-time.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinkers coupled with mass spectrometric analysis can identify interaction interfaces with amino acid resolution.

  • Cryo-electron microscopy: Single-particle analysis can reveal the structural basis of interactions within the assembled complex, providing insights into the spatial arrangement of psbA relative to other components.

  • Genetic approaches: Yeast two-hybrid or bacterial two-hybrid systems, modified for membrane proteins, can screen for novel interaction partners in a high-throughput manner.

When studying interactions involving psbA, it is important to maintain the native membrane environment or use appropriate membrane mimetics to preserve physiologically relevant interactions. Detergent selection is critical, as harsh detergents may disrupt weak but important interactions within the complex.

How does the sequence and function of psbA in Nicotiana tomentosiformis compare with other photosynthetic organisms?

Comparative analysis of psbA across diverse photosynthetic organisms reveals evolutionary conservation reflecting its fundamental role in photosynthesis. The psbA gene in N. tomentosiformis shows high sequence similarity to other Nicotiana species, with subtle differences that may influence protein function under specific environmental conditions.

When comparing N. tomentosiformis with other plants:

Understanding these comparative differences provides insights into the selective pressures that have shaped this essential photosynthetic protein across evolutionary time and diverse ecological contexts.

What insights can comparative chloroplast genomics provide for understanding psbA evolution and function in Nicotiana species?

Comparative chloroplast genomics offers valuable insights into the evolution and functional adaptation of psbA in Nicotiana species:

Table 2: Comparative Features of Chloroplast Genomes in Selected Nicotiana Species

SpeciesGene Regions (bp)Intergenic Regions (bp)Notable Features of psbA Region
N. tomentosiformis109,40446,341Located in LSC region, highly conserved coding sequence
N. tabacum cv. K326109,45746,569Similar organization to N. tomentosiformis with minor variations
N. otophora109,28846,624Close evolutionary relationship to N. tomentosiformis

This comparative approach provides a framework for understanding how psbA has evolved within the Nicotiana genus, offering insights into functional adaptations and evolutionary constraints .

How do post-translational modifications of psbA differ between species, and what are their functional implications?

Post-translational modifications (PTMs) of psbA play crucial roles in regulating protein turnover, repair cycles, and functional adjustments to varying environmental conditions. While specific data on N. tomentosiformis psbA modifications are not provided in the search results, general patterns observed across photosynthetic organisms provide insights:

  • Phosphorylation: The D1 protein (psbA) undergoes phosphorylation at N-terminal threonine residues in many species. This modification appears to regulate protein turnover under high light conditions, with phosphorylated D1 being more resistant to degradation.

  • Oxidative modifications: Specific amino acid residues, particularly those near the manganese cluster, can undergo oxidative modifications that serve as indicators of damage and triggers for protein replacement.

  • N-terminal processing: In many species, the initial translation product undergoes N-terminal processing to remove transit peptides or modify terminal residues, affecting protein stability and integration into the thylakoid membrane.

  • Acetylation: N-terminal acetylation has been observed in some species, potentially affecting protein stability and interactions with other PSII components.

The specific pattern of PTMs can vary between species, reflecting adaptations to different environmental conditions. For example, species adapted to high light environments may exhibit different patterns of phosphorylation compared to shade-adapted species. These modifications provide a mechanism for fine-tuning photosynthetic performance in response to changing conditions.

Understanding species-specific patterns of psbA post-translational modifications can provide insights into the adaptive strategies employed by different Nicotiana species in their respective ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.