Recombinant NIP3 homolog (dct-1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant NIP3 Homolog (dct-1)

The recombinant NIP3 homolog, known as dct-1, is a protein that plays a crucial role in cellular processes, particularly in the context of mitophagy. Mitophagy is a form of autophagy that specifically targets damaged or dysfunctional mitochondria for degradation, maintaining cellular homeostasis and promoting longevity. Dct-1 is a homolog of the mammalian proteins BNIP3 and NIX/BNIP3L, which are involved in mitochondrial quality control and mitophagy.

Function and Mechanism of dct-1

Dct-1 functions by promoting the selective degradation of mitochondria through mitophagy. This process is essential for maintaining mitochondrial quality and function, especially under conditions of stress or during aging. In Caenorhabditis elegans, dct-1 has been shown to mediate mitophagy, contributing to longevity by ensuring that damaged mitochondria are efficiently removed from cells .

Mechanism Overview

  • Mitochondrial Quality Control: dct-1 helps in identifying and marking damaged mitochondria for degradation.

  • Autophagy Pathway: It interacts with components of the autophagy machinery to facilitate the engulfment and degradation of targeted mitochondria.

Research Findings and Data

Recent studies have highlighted the importance of dct-1 in promoting longevity and maintaining cellular health. Here are some key findings:

4.1. Expression and Localization

Dct-1 is expressed in various tissues and is localized to mitochondria, where it plays a critical role in mitochondrial quality control. Its expression is often upregulated under conditions of stress, such as during hypoxia or when mitochondrial function is compromised.

4.2. Interaction with Other Proteins

Dct-1 interacts with other proteins involved in autophagy and mitochondrial function. These interactions are crucial for its role in mediating mitophagy and ensuring mitochondrial homeostasis.

4.3. Regulation of Mitophagy

The regulation of mitophagy by dct-1 involves the recognition and targeting of damaged mitochondria. This process is tightly regulated and involves complex interactions with other cellular pathways.

References

  1. Nip3 (nineteen kD interacting protein-3): A protein that interacts with Bcl-2 and E1B 19K, with homologs like dct-1 involved in mitophagy .

  2. DCT-1 in Mitophagy: A study highlighting dct-1's role in promoting longevity through mitophagy in C. elegans .

  3. Mitochondrial Quality Control: Research emphasizing the importance of maintaining mitochondrial function and quality, processes in which dct-1 plays a role .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
dct-1; C14F5.1; NIP3 homolog; CeBNIP3; Daf-16/FOXO controlled germline tumor affecting-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
dct-1
Target Protein Sequence
MLDIKRKINFASGEKTDESVQPQQQTEQSSAQQTTPSAKAVSNPFITPLTESTPGMSESW VELAPSRTSLCSSVDINMVIIDEKDKDSRLSPVSIAQSPHVEFESLEQVKYKLVREMLPP GKNTDWIWDWSSRPENTPPKTVRMVQYGSNLTTPPNSPEPELYQYLPCESDSLFNVRVVF GFLVTNIFSFVVGAAVGFAVCRKLIKHHRQ
Uniprot No.

Target Background

Function

Recombinant NIP3 homolog (dct-1) initiates apoptosis via a BH3-independent mechanism, potentially by recruiting ced-3 to mitochondria and other cytoplasmic membranes. It plays a role in lifespan regulation and tumor growth, and is essential for the induction of mitophagy under stress conditions.

Database Links

KEGG: cel:CELE_C14F5.1

STRING: 6239.C14F5.1a

UniGene: Cel.11376

Protein Families
NIP3 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in all somatic tissues including neurons, pharynx, intestine, body wall muscles and vulva muscles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.