Recombinant Nitratiruptor sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; NIS_0853; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Nitratiruptor sp. (strain SB155-2)
Target Names
atpB
Target Protein Sequence
MEGIFTFFGVISENHTFLFVSHMFLAALLTLIVAKLATKRLQVVPTGCQNVMEAYLEGVV AMGRDVIGESYAKKYLPLVATLGLFIFFANLMEIIPGFEPPSGNINFTLALALIVFIYYN FEGIRKNGVIHYFAHFAGPVKLLAPLMFPIEIVSHISRIISLSFRLFGNIKGDDLFVWVL LMLAPWIVPLPGFALMTFSAFLQTFIFMILTYVYLAGAVLLHEESL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the proton channel, directly involved in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of ATP synthase subunit a in Nitratiruptor sp.?

ATP synthase subunit a (atpB) in Nitratiruptor sp. is a membrane-embedded component of the F₀ sector of ATP synthase. The protein consists of 226 amino acids with multiple transmembrane segments that form crucial channels for proton translocation. Based on available sequence data, the protein has a predominantly hydrophobic character with several transmembrane helices .

The full amino acid sequence is: MEGIFTFFGVISENHTFLFVSHMFLAALLTLIVAKLATKRLQVVPTGCQNVMEAYLEGVVAMGRDVIGESYAKKYLPLVATLGLFIFFANLMEIIPGFEPPSGNINFTLALALIVFIYYNFEGIRKNGVIHYFAHFAGPVKLLAPLMFPIEIVSHISRIISLSFRLFGNIKGDDLFVWVLLLMLAMPWIVPLPGFALMTFSAFLQTFIFMILTYLYLAGAVLLHEESL .

Functionally, subunit a works in conjunction with the c-ring to create a pathway for protons to flow down their electrochemical gradient across the membrane. This proton flow drives the rotation of the c-ring, which in turn drives conformational changes in the F₁ sector catalyzing ATP synthesis. The subunit contains critical residues that are essential for proton translocation and the rotary mechanism of ATP synthase .

How does ATP synthase organization differ between Nitratiruptor sp. and other bacterial species?

ATP synthase organization shows interesting variations across bacterial species, particularly in the arrangement of genes encoding its components. In most bacteria, ATP synthase subunits are encoded by the atp operon.

In Nitratiruptor sp., the atpB gene encodes the subunit a of the F₀ sector. This organization is somewhat similar to that found in Rhodobacter capsulatus, where genes for the F₀ sector are arranged in the order: atpI (subunit I), atpB (subunit a), atpE (subunit c), atpX (subunit b'), and atpF (subunit b) .

The comparison below highlights key differences in ATP synthase subunit organization across species:

SpeciesF₀ Sector Gene OrganizationNotable Features
Nitratiruptor sp.atpB for subunit aExtremophile adaptation
R. capsulatusatpI-atpB-atpE-atpX-atpFDuplicated b subunit (b')
E. coliatpB-atpE-atpF-atpH-atpASingle b subunit
MitochondriaATP6 for subunit aEncoded by mitochondrial genome

What are the optimal expression systems for recombinant Nitratiruptor sp. ATP synthase subunit a?

For expressing recombinant Nitratiruptor sp. ATP synthase subunit a, several expression systems can be considered based on the challenges associated with membrane protein expression:

E. coli-based expression systems are commonly used due to their high yield and ease of genetic manipulation. When expressing membrane proteins like ATP synthase subunit a, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for toxic or membrane protein expression often provide better results. Using a pET-based expression system with an N-terminal His-tag or other affinity tags facilitates subsequent purification steps .

For successful expression:

  • Optimize codon usage for E. coli

  • Use lower induction temperatures (16-25°C) to slow protein production and facilitate proper folding

  • Consider using weaker promoters to prevent accumulation of misfolded protein

  • Include appropriate detergents during cell lysis (e.g., n-dodecyl-β-D-maltoside)

For proteins that are challenging to express in E. coli, Pichia pastoris or insect cell expression systems may offer advantages, particularly for maintaining proper folding and post-translational modifications. The data from successful expression of related ATP synthase components suggests that achieving functional recombinant protein requires careful consideration of membrane integration and protein folding kinetics .

What purification strategy yields the highest purity and activity for recombinant ATP synthase subunit a?

Purification of recombinant ATP synthase subunit a requires specialized approaches due to its hydrophobic nature and membrane association. A multi-step purification strategy typically yields the best results:

  • Membrane isolation: Following cell lysis, carefully separate the membrane fraction containing the recombinant protein through differential centrifugation.

  • Detergent solubilization: Solubilize the membrane fraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations slightly above their critical micelle concentration (CMC). This is a critical step as detergent choice significantly impacts protein stability and activity .

  • Affinity chromatography: Utilize the affinity tag (commonly His-tag) for initial purification using Ni-NTA or similar matrices. Include the appropriate detergent in all buffers to maintain protein solubility.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography removes aggregates and provides a more homogeneous preparation.

For highest activity retention, all buffers should contain stabilizing agents such as glycerol (typically 10-20%) and appropriate salt concentrations (150-300 mM NaCl). As observed with the commercial preparation, a storage buffer containing Tris-based buffer with 50% glycerol is optimal for maintaining stability during storage .

The purification yield and activity can be monitored at each step using SDS-PAGE, Western blotting with anti-ATP synthase antibodies, and functional assays where applicable .

How can researchers design functional assays to evaluate the activity of recombinant ATP synthase subunit a?

Designing functional assays for recombinant ATP synthase subunit a presents unique challenges since the isolated subunit doesn't possess catalytic activity on its own. Instead, researchers should focus on its role within the complete ATP synthase complex:

Reconstitution Approaches:

  • Co-express subunit a with other F₀ components (particularly c subunits) to form a partial F₀ complex

  • Reconstitute the subunit into proteoliposomes to measure proton translocation

  • Complement ATP synthase-deficient bacterial strains with the recombinant protein

Functional Measurements:
For reconstituted complexes containing subunit a, researchers can measure:

  • Proton translocation using pH-sensitive fluorescent dyes

  • ATP hydrolysis activity when combined with the F₁ sector

  • ATP synthesis when the complete complex is reconstituted in liposomes with an artificially imposed proton gradient

In research settings, the activity of complete ATP synthase complexes containing subunit a can be assessed by:

  • The ATP hydrolysis-driven proton pumping (reverse direction)

  • Proton gradient-driven ATP synthesis (forward direction)

Recent research with bacterial F₁-ATPase complexes demonstrates that heterologous expression systems can be used to measure the impact of mutations in ATP synthase subunits on both ATP hydrolysis and synthesis capabilities .

What structural characterization methods are most effective for studying Nitratiruptor sp. ATP synthase subunit a?

Given the hydrophobic nature and membrane integration of ATP synthase subunit a, specialized structural characterization methods are required:

Cryo-electron microscopy (cryo-EM) has emerged as the method of choice for determining the structure of complete ATP synthase complexes or subcomplexes. The recent 3.0 Å cryo-EM structure of A. baumannii F₁-ATPase demonstrates the power of this approach for visualizing membrane protein architecture and regulatory elements .

Other complementary approaches include:

  • NMR spectroscopy: Particularly useful for studying dynamics and ligand interactions. Solution NMR has been successfully applied to determine structures of individual ATP synthase subunits, as demonstrated with the solution structure of the ε subunit from A. baumannii .

  • Cross-linking mass spectrometry (XL-MS): Helps identify interaction interfaces between subunit a and other components of the ATP synthase complex.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility.

  • Molecular dynamics simulations: Can predict structural arrangements and dynamics of membrane-embedded regions that are difficult to resolve experimentally.

For the specific case of Nitratiruptor sp., which is an extremophile, incorporating environmental factors that mimic its native conditions (temperature, pH, salt concentration) during structural studies is critical for obtaining physiologically relevant information .

How do mutations in key residues of ATP synthase subunit a affect proton translocation and enzyme function?

Key functional residues typically include:

  • Conserved arginine residue that is essential for proton translocation

  • Polar residues that form the proton pathway

  • Hydrophobic residues that maintain structural integrity and interaction with the c-ring

Research approaches to study mutation effects include:

  • Site-directed mutagenesis of conserved residues followed by functional analysis in reconstituted systems or complementation assays

  • Molecular dynamics simulations to predict how mutations alter proton access channels or subunit interactions

  • Structural comparisons between wild-type and mutant proteins using cryo-EM or other structural techniques

The impact of mutations can be quantified by measuring:

  • Changes in ATP synthesis/hydrolysis rates

  • Alterations in proton translocation efficiency

  • Shifts in enzyme kinetics (Km, Vmax)

  • Effects on assembly of the complete ATP synthase complex

Studies with bacterial ATP synthases have shown that even single amino acid substitutions can result in significant changes in enzymatic activity. For example, research with A. baumannii F₁-ATPase demonstrated that mutations in the ε subunit dramatically affected ATP hydrolysis, with a 21.5-fold increase observed when this regulatory subunit was removed entirely .

What evolutionary adaptations can be observed in ATP synthase subunit a from extremophiles like Nitratiruptor sp.?

Nitratiruptor sp. is an extremophile that lives in harsh environments, which has driven evolutionary adaptations in its ATP synthase components to maintain functionality under extreme conditions.

Notable adaptations in ATP synthase subunit a from extremophiles often include:

  • Increased hydrophobicity: Analysis of the amino acid sequence of Nitratiruptor sp. ATP synthase subunit a reveals a highly hydrophobic profile with multiple transmembrane segments, which contributes to membrane stability under extreme conditions .

  • Modified proton binding sites: Altered pKa values of key amino acids involved in proton translocation to maintain function at extreme pH values.

  • Enhanced thermal stability: Increased number of salt bridges, hydrogen bonds, and hydrophobic interactions that contribute to protein stability at high temperatures.

  • Specialized lipid interactions: Adaptations in the lipid-facing surfaces of the protein to interact with the unique membrane lipid composition of extremophiles.

Comparative analysis of ATP synthase subunit a sequences across species reveals conservation patterns that highlight functionally critical regions versus adaptable regions:

RegionConservation LevelAdaptive Features in Extremophiles
Proton channelHighly conservedSubtle amino acid substitutions preserving function under extreme conditions
Lipid-facing surfacesModerately variableIncreased hydrophobicity and specialized interactions with extremophile lipids
Interfaces with other subunitsConserved structural motifsStrengthened interaction surfaces to maintain complex stability

These adaptations not only provide insights into protein evolution but also offer valuable information for biotechnological applications, including the engineering of highly stable ATP synthases for bioenergetic research or biotechnological applications .

What are the common challenges in expressing and purifying recombinant ATP synthase subunit a, and how can researchers overcome them?

Expression and purification of recombinant ATP synthase subunit a present several challenges due to its hydrophobic nature and membrane association:

Challenge 1: Poor expression levels

  • Solution: Optimize codon usage for the expression host, use specialized strains designed for membrane proteins (C41/C43), lower induction temperature (16-20°C), and test different promoter strengths.

  • Implementation: Create a series of expression constructs with varying promoters, tags, and fusion partners (e.g., MBP, SUMO) to improve solubility without compromising function.

Challenge 2: Protein misfolding and aggregation

  • Solution: Include molecular chaperones (co-express GroEL/GroES), optimize detergent selection during extraction, and consider fusion with stability-enhancing tags.

  • Implementation: Screen a panel of detergents using small-scale extractions followed by analytical SEC to identify conditions that yield monodisperse protein.

Challenge 3: Loss of activity during purification

  • Solution: Minimize exposure to harsh conditions, maintain appropriate detergent concentrations throughout purification, include stabilizing agents (glycerol, specific lipids), and reduce purification steps.

  • Implementation: As observed with commercial preparations, storage in 50% glycerol in a Tris-based buffer helps maintain stability, and working aliquots should be kept at 4°C for no more than one week to preserve activity .

Challenge 4: Difficulty in assessing functional integrity

  • Solution: Develop indirect assays that can evaluate structural integrity as a proxy for function, such as ligand binding or interaction with partner proteins.

  • Implementation: Use antibody-based detection methods to confirm proper folding, or assess interactions with other ATP synthase subunits using pull-down assays .

How can researchers effectively reconstitute recombinant ATP synthase subunit a into functional complexes for structural and functional studies?

Reconstitution of recombinant ATP synthase subunit a into functional complexes is essential for many structural and functional studies. The following methodological approach can increase success rates:

Step 1: Preparation of purified components

  • Ensure high purity of all components (>95% by SDS-PAGE)

  • Maintain proteins in stabilizing buffers with appropriate detergents

  • Consider co-purification approaches if individual components are unstable

Step 2: Reconstitution into proteoliposomes

  • Select lipids that mimic the native membrane environment (e.g., E. coli total lipid extract plus additional phosphatidylethanolamine)

  • Use the detergent removal method:

    • Mix proteins and lipids in detergent-containing buffer

    • Remove detergent gradually using Bio-Beads or dialysis

    • Control protein:lipid ratios carefully (typically 1:100 to 1:50 w/w)

Step 3: Verification of successful reconstitution

  • Perform freeze-fracture electron microscopy to visualize protein incorporation

  • Use fluorescence recovery after photobleaching (FRAP) to assess protein mobility

  • Conduct functional assays such as proton translocation measurements

Step 4: Complex assembly monitoring

  • Analyze samples using blue native PAGE to confirm complex formation

  • Use size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine complex stoichiometry

  • Apply single-molecule techniques to assess conformational states

Recent research with bacterial F₁-ATPases demonstrates that reconstituted complexes can be successfully used for high-resolution cryo-EM studies, which provide valuable structural information about the assembly and interactions between subunits .

How does ATP synthase subunit a from Nitratiruptor sp. compare structurally and functionally to equivalent subunits in other extremophiles?

Comparing ATP synthase subunit a across extremophiles reveals important adaptations to diverse environmental conditions:

Structural Comparison Across Extremophile Species:

Extremophile TypeRepresentative SpeciesKey Adaptations in Subunit aFunctional Implications
ThermophileThermus thermophilusIncreased hydrophobic interactions, additional salt bridgesThermal stability at high temperatures (70-80°C)
AcidophilePicrophilus torridusModified proton-binding residues, altered surface chargeFunction at extremely low pH (pH 0-1)
HalophileHalobacterium salinarumIncreased proportion of acidic residues on surfaceStability in high salt concentrations
Deep-seaNitratiruptor sp.Pressure-resistant structural featuresAdaptation to high pressure environments

The amino acid sequence of Nitratiruptor sp. ATP synthase subunit a shows adaptations typical for organisms living in extreme environments, including hydrophobic regions that maintain structural integrity under pressure. The protein contains unique sequences in the transmembrane domains that are likely adaptations to its specific environmental niche .

Functional Comparisons:
Research approaches to compare functionality include:

  • Enzyme kinetics measurements under various conditions (temperature, pH, pressure)

  • Thermal stability assays comparing denaturation profiles

  • Proton translocation efficiency measurements

These comparative analyses provide insights into convergent and divergent evolutionary solutions to environmental challenges and can inform the rational design of bioengineered ATP synthases with tailored properties .

What insights can be gained from studying ATP synthase subunit a for understanding bioenergetic adaptations to extreme environments?

Studying ATP synthase subunit a from extremophiles like Nitratiruptor sp. provides valuable insights into bioenergetic adaptations that allow life to thrive in challenging environments:

Mechanistic Insights:

  • Proton pathway modifications: Extremophiles often display subtle modifications in the proton translocation pathway that maintain function under conditions that would disrupt typical enzymes. These include altered pKa values of key residues and modified water-accessible channels.

  • Structural flexibility vs. rigidity balance: The protein must maintain sufficient rigidity to preserve its structure while allowing necessary conformational changes during the catalytic cycle. Extremophiles achieve this balance through specialized adaptations in hinge regions and interaction surfaces.

  • Energy coupling efficiency: Some extremophiles have evolved to function with modified proton motive force parameters, requiring adaptations in how subunit a couples proton movement to c-ring rotation.

Research Applications:

  • Biotechnological applications: Understanding these adaptations can inform the design of highly stable ATP synthases for biotechnological applications such as nanomotors or synthetic bioenergetic systems.

  • Evolutionary biology: Comparative analysis reveals convergent evolution strategies and helps trace the evolutionary history of bioenergetic systems.

  • Astrobiology: Insights from extremophile adaptations inform our understanding of potential bioenergetic solutions in extraterrestrial environments.

The unique features of ATP synthase subunit a in extremophiles like Nitratiruptor sp. highlight how fundamental bioenergetic principles can be preserved while allowing significant structural adaptation to environmental challenges. This versatility underscores why ATP synthase is considered one of the most ancient and conserved enzymes in all domains of life .

How might ATP synthase inhibitors that target subunit a be developed as potential antimicrobial agents against pathogenic bacteria?

ATP synthase represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. Developing inhibitors specifically targeting subunit a offers several advantages:

Rational Design Approach:

  • Structural analysis: Identify unique structural features of bacterial subunit a that differ from human mitochondrial homologs

  • Molecular docking: Screen compound libraries against these unique structural features

  • Optimization: Refine lead compounds for improved specificity and pharmacokinetic properties

The success of bedaquiline (R207910) against drug-resistant Mycobacterium tuberculosis demonstrates the validity of targeting ATP synthase. This drug targets subunit c, blocking bacterial ATP synthases and preventing ATP synthesis . Similar approaches could be developed for subunit a, potentially offering advantages in terms of specificity.

Key considerations for developing subunit a-specific inhibitors:

  • Focus on regions with low sequence homology between bacterial and human ATP synthases

  • Target interfaces between subunit a and other components specific to bacterial systems

  • Design compounds that disrupt proton translocation without affecting structural integrity

Experimental approaches:

  • High-throughput screening against reconstituted bacterial ATP synthase

  • Structure-guided medicinal chemistry optimization

  • Validation in bacterial growth assays and human cell toxicity tests

The development of such inhibitors would represent a significant advance in addressing antimicrobial resistance, especially for infections caused by ESKAPE pathogens like Acinetobacter baumannii which rely heavily on oxidative phosphorylation .

What novel techniques are emerging for studying protein-protein interactions within the ATP synthase complex involving subunit a?

Several cutting-edge techniques are emerging for studying the complex protein-protein interactions within ATP synthase, particularly those involving the membrane-embedded subunit a:

1. Single-particle cryo-electron microscopy (cryo-EM) with improved resolution:
Recent advances have enabled the determination of ATP synthase structures at near-atomic resolution, as demonstrated by the 3.0 Å structure of A. baumannii F₁-ATPase . These improvements allow visualization of detailed interactions between subunits.

2. Integrative structural biology approaches:
Combining multiple techniques provides a more comprehensive understanding of protein interactions:

Advanced fluorescence techniques:

  • Förster resonance energy transfer (FRET) sensors designed to detect conformational changes during catalysis

  • Single-molecule FRET to observe conformational states without ensemble averaging

  • Fluorescence correlation spectroscopy (FCS) to study interaction kinetics

In situ structural approaches:

  • Cryo-electron tomography (cryo-ET) to study ATP synthase structure in native membrane environments

  • Correlative light and electron microscopy (CLEM) to connect functional states with structural features

Advanced computational methods:

  • Deep learning approaches to predict protein-protein interaction interfaces

  • Molecular dynamics simulations at extended timescales to capture conformational changes

  • Coevolutionary analysis to identify co-evolving residues that may form contact points

These emerging techniques are providing unprecedented insights into how subunit a interacts with other components of the ATP synthase complex, particularly during the critical processes of proton translocation and rotary catalysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.