Recombinant Nitratiruptor sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant nuoK is produced under standardized conditions:

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His tag
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C

Mutagenesis studies highlight the functional importance of (K)Glu-36 and (K)Glu-72 in TM2 and TM3, respectively. Shifting these residues disrupts proton translocation efficiency .

Functional Role in NDH-1

NDH-1 (Complex I homolog) couples electron transfer from NADH to quinone with proton pumping. Key findings include:

  • Proton Translocation Mechanism: NuoK’s TM2 and TM3 helices form part of the proton channel. Mutation of (K)Glu-36 to Ala abolishes activity, while (K)Glu-72 mutations reduce it moderately .

  • Cytoplasmic Loop Function: Residues (K)Arg-25, (K)Arg-26, and (K)Asn-27 in loop-1 are critical for energy transduction, likely stabilizing conformational changes during catalysis .

Research Applications

This recombinant protein is utilized in:

  • Enzyme Kinetics: Studying quinone reduction rates and inhibitor binding (e.g., dicoumarol) .

  • Structural Biology: Mapping transmembrane domain interactions via cysteine crosslinking .

  • Biophysical Studies: Probing proton translocation using liposome-based assays .

Key Research Findings

Recent studies emphasize:

  • Conserved Residue Mobility: Relocating (K)Glu-36 within TM2 preserves activity if positioned near the original site, suggesting flexibility in helix packing .

  • Disease Relevance: While human NQO1 is linked to cancer, bacterial nuoK homologs are explored for antimicrobial drug targeting .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NIS_0299; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Nitratiruptor sp. (strain SB155-2)
Target Names
nuoK
Target Protein Sequence
MITLTHYLILSAILFSIALVGILRRKNLLMLFFATEIALNAVNIALAAFSKYYGDLTGQL FAFFIIAIAASEVAVGLGLLIIWYKRRGTIDLDSLQSMNG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. It couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitratiruptor sp. and why is it significant for studying NADH-quinone oxidoreductase?

Nitratiruptor sp. represents one of the most abundant chemolithoautotrophic Campylobacterota populations found in the mixing zones between hydrothermal fluids and ambient seawater in deep-sea environments . The genus includes several species, including Nitratiruptor tergarcus, Nitratiruptor labii, and Nitratiruptor sp. SB155-2, which have been identified through phylogenetic analysis based on 16S rRNA gene sequences . These organisms thrive in extreme environments and possess unique metabolic capabilities tied to energy conservation, making their NADH-quinone oxidoreductase complex particularly interesting for studying adaptive respiratory mechanisms in thermophilic bacteria.

Methodologically, when approaching Nitratiruptor research, begin with proper strain identification using both 16S rRNA sequencing and whole-genome approaches. Comparative analysis should include in silico DNA-DNA hybridization (DDH), average nucleotide identity (ANI), and average amino acid identity (AAI) calculations against genomes of related species to ensure accurate taxonomic placement .

How does the nuoK subunit function within the NADH-quinone oxidoreductase complex?

The nuoK subunit functions as an integral membrane component of the NADH-quinone oxidoreductase (Complex I) in Nitratiruptor sp. Within the respiratory chain, this complex couples electron transfer from NADH to quinones with proton translocation across the membrane, contributing to the proton motive force used for ATP synthesis. In thermophilic bacteria like Nitratiruptor, these complexes often exhibit structural adaptations that enhance stability at high temperatures.

When studying nuoK function, employ membrane topology analysis using computational prediction tools in conjunction with experimental validation through reporter fusion techniques. For functional characterization, site-directed mutagenesis of conserved residues followed by activity assays measuring NADH oxidation rates and proton translocation efficiency provides valuable insights into structure-function relationships.

What are the key differences between Nitratiruptor sp. respiratory complexes and those in model organisms?

Nitratiruptor species possess respiratory complexes adapted to function optimally in extreme deep-sea hydrothermal environments. Unlike model organisms such as E. coli, Nitratiruptor sp. has evolved specialized features in its respiratory chain, particularly in relation to electron acceptor utilization. The respiratory chain of Nitratiruptor includes components for nitrate reduction and potentially novel nitric oxide reduction pathways that differ from those found in conventional model systems .

Genomic analysis reveals that while Nitratiruptor sp. SB155-2 lacks certain nitric oxide reduction mechanisms (like gNOR) found in related organisms such as Sulfurimonas denitrificans, it contains alternative adaptations in its respiratory complexes . When comparing respiratory systems between Nitratiruptor and model organisms, employ both genomic and biochemical approaches, focusing on cofactor composition, electron transfer kinetics, and temperature-activity profiles to identify unique adaptations.

What are the optimal conditions for expressing recombinant Nitratiruptor sp. nuoK in heterologous systems?

For successful heterologous expression of Nitratiruptor sp. nuoK, consider the following methodological approach:

ParameterRecommended ConditionRationale
Expression HostE. coli C43(DE3) or Rosetta strainBetter for membrane protein expression
Induction Temperature18-20°CReduces inclusion body formation
Inducer Concentration0.1-0.3 mM IPTGLower concentrations favor proper folding
Growth MediaTB or 2XYT with added trace elementsSupports higher cell density
Expression Time16-20 hours post-inductionAllows sufficient time for proper folding

When designing your expression system, codon optimization is essential since Nitratiruptor sp. has a different codon usage pattern than E. coli. Include a purification tag (His6 or Strep-tag) preferably at the C-terminus to minimize interference with membrane insertion. For membrane proteins like nuoK, supplementing the growth medium with specific phospholipids can enhance proper folding and stability during expression.

Monitor expression through Western blotting rather than relying solely on SDS-PAGE, as membrane proteins often appear diffuse on gels. When troubleshooting poor expression, systematically vary the parameters above while maintaining careful controls for comparison.

How can researchers overcome challenges in purifying functional recombinant nuoK protein?

Purification of functional recombinant nuoK presents significant challenges due to its hydrophobic nature and membrane integration. A systematic approach should include:

  • Membrane fraction isolation: Employ differential centrifugation followed by sucrose gradient ultracentrifugation to obtain purified membrane fractions.

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) at different concentrations to identify optimal solubilization conditions that maintain protein activity.

  • Chromatography strategy: Implement a multi-step purification process involving:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) using the His-tag

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography as a final polishing step

  • Stability assessment: Monitor protein stability throughout purification using activity assays and thermal shift assays.

When encountering aggregation issues, consider adding stabilizing agents such as glycerol (10-15%) or specific lipids that mimic the native membrane environment of Nitratiruptor sp. For activity preservation, maintain reducing conditions throughout purification by including reducing agents like DTT or β-mercaptoethanol in all buffers.

Researchers should validate protein functionality post-purification through activity assays measuring NADH oxidation rates and, if possible, reconstitution into proteoliposomes to assess proton pumping activity.

What are the best approaches for studying the interaction between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

To effectively study interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex, employ a multi-faceted approach:

  • Cross-linking studies: Use chemical cross-linkers of varying lengths followed by mass spectrometry analysis to identify interaction interfaces.

  • Co-immunoprecipitation: Develop specific antibodies against nuoK or use epitope tags for pull-down experiments to identify interacting partners.

  • Bacterial two-hybrid analysis: Adapt bacterial two-hybrid systems to test specific subunit interactions in a controlled environment.

  • Cryogenic electron microscopy: For structural studies, purify the entire complex or reconstitute key subunits for high-resolution imaging of interaction domains.

When analyzing data from these experiments, triangulate findings from multiple approaches rather than relying on a single technique. Contradictory results should be investigated further rather than dismissed, as they may reveal dynamic or condition-dependent interactions . Negative results should be documented carefully, as they provide valuable information about which subunits do not directly interact with nuoK.

How should researchers address contradictory results when studying nuoK activity in various experimental systems?

When facing contradictory results in nuoK research, implement the following structured approach:

First, thoroughly examine the data to identify specific discrepancies, paying particular attention to outliers that may have influenced results . Document experimental conditions meticulously, as seemingly minor variations in pH, temperature, or ionic strength can significantly affect membrane protein behavior.

Evaluate your initial assumptions and research design, considering whether the experimental system adequately mimics the native environment of Nitratiruptor sp., which thrives in deep-sea hydrothermal vents under specific conditions . The thermophilic nature of Nitratiruptor may require adjustments to standard protocols designed for mesophilic systems.

Consider alternative explanations for contradictory data, such as:

  • Post-translational modifications affecting nuoK in certain expression systems

  • Differences in membrane composition affecting protein integration and function

  • Presence of contaminating proteins or inhibitory compounds

  • Variations in protein stability under different assay conditions

Modify your data collection process if necessary, and implement additional controls that specifically address potential sources of variability . Cross-validation using complementary techniques provides stronger evidence and helps resolve contradictions.

What statistical approaches are most appropriate for analyzing nuoK structure-function relationship data?

When analyzing structure-function relationship data for nuoK, employ these statistical approaches:

When presenting statistical results, include both raw data and processed results, with appropriate visualization through heat maps for mutation effects or radar plots for multidimensional comparisons of different experimental conditions. Always report effect sizes alongside p-values to provide a complete picture of biological significance beyond statistical significance.

How can researchers distinguish between direct effects of nuoK mutations and indirect effects on complex assembly?

Distinguishing between direct functional effects of nuoK mutations and indirect effects on complex assembly requires a systematic experimental design:

  • Blue Native PAGE analysis: Use this technique to compare the integrity of the entire NADH-quinone oxidoreductase complex between wild-type and mutant versions.

  • Stepwise complex assembly assays: Develop in vitro reconstitution systems to monitor the assembly process with wild-type versus mutant nuoK.

  • Thermal stability measurements: Compare the melting temperatures of isolated subcomplexes containing wild-type or mutant nuoK to assess structural integrity.

  • Activity measurements at different levels:

    • Measure electron transfer in the isolated nuoK-containing subcomplex

    • Assess proton pumping in reconstituted proteoliposomes

    • Evaluate NADH oxidation rates in the complete complex

By comparing these multi-level measurements, researchers can create a comprehensive profile that distinguishes assembly defects from functional impairments. When interpreting contradictory data between these levels, consider using a decision matrix approach that weights different lines of evidence based on their directness and reliability .

How can cryo-EM techniques be optimized for structural studies of Nitratiruptor sp. respiratory complexes containing nuoK?

Optimizing cryo-EM for Nitratiruptor sp. respiratory complexes requires addressing several technical challenges:

  • Sample preparation optimization:

    • Test detergent screening beyond conventional options, including novel amphipathic polymers like SMA (styrene-maleic acid) that extract membrane proteins with their native lipid environment

    • Evaluate nanodiscs with varying lipid compositions that mimic the Nitratiruptor native membrane

    • Explore GraFix (gradient fixation) technique to stabilize the complex prior to vitrification

  • Grid preparation considerations:

    • Test continuous carbon versus holey carbon films with thin carbon support

    • Optimize blotting conditions to achieve ideal ice thickness for the complex

    • Consider glow discharge parameters to adjust surface hydrophilicity

  • Data collection strategy:

    • Implement beam-tilt series acquisition to collect data at multiple defocus values

    • Use energy filters to enhance contrast, particularly important for membrane proteins

    • Consider collecting tilt series data to address preferred orientation issues common with membrane proteins

  • Processing workflow:

    • Apply 3D variability analysis to capture conformational heterogeneity

    • Implement focused refinement strategies for the nuoK region

    • Consider multi-body refinement to account for domain movements

When analyzing complex integrity, compare the obtained structure with homologous complexes from related organisms, noting both conserved features and unique aspects of the Nitratiruptor complex.

What approaches can be used to study the role of nuoK in electron transport chain supercomplexes in Nitratiruptor sp.?

To investigate nuoK's role in supercomplex formation and function:

  • Native complex isolation:

    • Develop gentle solubilization protocols using digitonin or amphipathic polymers

    • Implement density gradient ultracentrifugation to separate individual complexes from supercomplexes

    • Use Blue Native PAGE with in-gel activity staining to identify active supercomplexes

  • Interaction mapping:

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify protected interfaces

    • Use site-specific cross-linking combined with mass spectrometry to map interaction points

    • Develop proximity labeling approaches using engineered peroxidases fused to nuoK

  • Functional characterization:

    • Compare electron transfer rates in isolated complexes versus supercomplexes

    • Measure ROS production in various assembly states to assess electron leakage

    • Evaluate the efficiency of energy conservation through proton gradient measurements

  • In situ studies:

    • Develop protocols for membrane vesicle preparation from Nitratiruptor cells

    • Apply fluorescence recovery after photobleaching (FRAP) with labeled components to assess dynamics

    • Consider cryo-electron tomography of Nitratiruptor membranes to visualize native arrangements

When interpreting data, consider that Nitratiruptor's adaptation to hydrothermal vent environments may yield unique supercomplex arrangements compared to model organisms, particularly in relation to nitrogen metabolism components that may interact with the respiratory chain .

How does nuoK contribute to the adaptation of Nitratiruptor sp. to deep-sea hydrothermal environments?

The nuoK subunit plays several critical roles in adapting Nitratiruptor sp. to the extreme conditions of deep-sea hydrothermal environments:

  • Thermostability mechanisms:

    • Analyze the amino acid composition of nuoK, focusing on increased hydrophobic core packing and salt bridge networks

    • Compare thermal denaturation profiles between Nitratiruptor nuoK and homologs from mesophilic bacteria

    • Identify potential stabilizing interactions with specific membrane lipids

  • Pressure adaptation:

    • Investigate volume changes during catalytic cycle using pressure-perturbation spectroscopy

    • Measure activity under varying pressure conditions to identify optimal pressure ranges

    • Conduct molecular dynamics simulations to identify conformational changes under pressure

  • Integration with alternative respiratory pathways:

    • Examine potential interactions between Complex I and nitrate reduction machinery

    • Investigate how electron flow through nuoK-containing complexes connects to N2O reduction pathways, which appear to be significant in Nitratiruptor species

    • Analyze the gene clusters containing nuoK for co-regulation with other stress response elements

Adaptation AspectNitratiruptor sp.Mesophilic Counterparts
Operating Temperature Range55-65°C optimal25-37°C optimal
Hydrostatic Pressure ToleranceHigh (deep-sea conditions)Low to moderate
Membrane Lipid CompositionHigher saturation, unique head groupsLower saturation, standard composition
Proton Pumping EfficiencyOptimized for low pH environmentsOptimized for neutral pH
Electron Acceptor FlexibilityAdapted for limited O2, alternative acceptorsPrimarily O2-oriented

When studying these adaptations, combine comparative genomics with biochemical characterization to establish structure-function relationships specific to the extreme environment of deep-sea hydrothermal vents .

What emerging technologies might advance our understanding of nuoK function in Nitratiruptor sp.?

Several cutting-edge technologies show promise for nuoK research:

  • Cryo-electron tomography: This technique can visualize respiratory complexes in their native membrane environment, potentially revealing how nuoK positioning affects supercomplex formation in intact Nitratiruptor cells.

  • Single-molecule FRET: Applying this approach to reconstituted systems can capture dynamic conformational changes in nuoK during the catalytic cycle that are invisible to static structural methods.

  • Microfluidic cultivation systems: These platforms can simulate hydrothermal vent gradients, allowing real-time observation of respiratory adaptation in living Nitratiruptor cells under varying conditions.

  • AlphaFold and related AI structure prediction tools: These can model nuoK structures and interactions with increasing accuracy, generating testable hypotheses about functional domains.

  • CRISPR-based technologies: Adapting genetic manipulation tools for Nitratiruptor would enable in vivo validation of nuoK function through precisely engineered mutations.

  • Nanopore-based techniques: These emerging approaches could measure proton translocation at the single-complex level, providing unprecedented resolution of nuoK's role in energy conservation.

When implementing these technologies, researchers should consider developing collaborative networks with specialized facilities, as many require substantial infrastructure investment and technical expertise beyond individual laboratories.

How might comparative studies between Nitratiruptor sp. and related genera inform our understanding of nuoK evolution?

Comparative studies between nuoK from Nitratiruptor sp. and related genera offer valuable evolutionary insights:

  • Phylogenetic analysis framework:

    • Construct robust phylogenetic trees using both nuoK sequences and whole-genome approaches

    • Apply molecular clock analyses to estimate divergence times in relation to geological events

    • Use selection pressure analysis (dN/dS ratios) to identify residues under positive selection

  • Structure-function comparative approaches:

    • Map conserved versus variable regions onto structural models

    • Compare substrate specificities and kinetic parameters across taxa

    • Analyze adaptive changes in relation to habitat-specific challenges (temperature, pressure, electron acceptor availability)

  • Horizontal gene transfer assessment:

    • Examine synteny of nuoK and surrounding genes across Campylobacteria

    • Identify potential recombination events that might have influenced nuoK evolution

    • Compare phage interactions among different genera, as phages may facilitate gene transfer

The genus Nitratiruptor shows distinct genomic features compared to related genera such as Sulfurimonas, particularly in nitrogen metabolism pathways . These differences likely extend to energy conservation mechanisms involving nuoK. Comparing Nitratiruptor with Nitratiruptor labii and other species within the genus can reveal more recent evolutionary adaptations .

What are the potential applications of understanding nuoK function for bioenergy and bioremediation research?

Understanding nuoK function in Nitratiruptor sp. has significant implications for applied research:

  • Bioenergy applications:

    • Engineer thermostable respiratory complexes based on Nitratiruptor models for improved microbial fuel cells

    • Develop biomimetic catalysts inspired by the electron transfer mechanisms in nuoK

    • Create hybrid systems incorporating thermostable components from Nitratiruptor into production strains

  • Bioremediation potential:

    • Apply insights from Nitratiruptor's nitrogen metabolism to engineer enhanced denitrification systems

    • Develop biofilters utilizing thermophilic respiratory mechanisms for industrial waste treatment

    • Create biosensors based on nuoK components to detect specific pollutants in extreme environments

  • Biotechnology platforms:

    • Utilize Nitratiruptor-derived components as parts for synthetic biology in harsh environments

    • Develop expression systems optimized for membrane protein production based on Nitratiruptor mechanisms

    • Create cell-free systems incorporating thermostable respiratory components for sustainable catalysis

Research shows that Nitratiruptor species possess remarkable N2O reduction capabilities, with certain strains showing the highest levels of consumption . This nitrogen cycling ability, coupled with the thermostability of their respiratory components, makes them particularly valuable for developing technologies targeting nitrogen pollution under challenging conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.