Recombinant Nitric oxide reductase subunit C (norC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
norC; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-150
Protein Length
Full Length of Mature Protein
Species
Paracoccus denitrificans
Target Names
norC
Target Protein Sequence
SEIMTKNMARNVFYGGSIFFILIFGALTVHSHIYARTKAVDESQLTPSVVEGKHIWERNA CIDCHTLLGEGAYFAPELGNVMKRWGVQDDPDSAFETLKGWMESMPTGIEGRRQMPRFDL TDEEFRALSDFLLWTGTINTQNWPPNDAG
Uniprot No.

Target Background

Function
A component of the anaerobic respiratory chain, responsible for the conversion of nitrate to dinitrogen (denitrification).
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Nitric oxide reductase subunit C (norC) and how does it function in bacterial systems?

NorC is a monoheme c-type cytochrome that serves as one of the main subunits in cytochrome c-dependent nitric oxide reductases (cNOR). It possesses an N-terminal transmembrane helix that anchors the heme domain to the periplasmic face of the cytoplasmic membrane. Functionally, norC relays electrons from periplasmic donor proteins (cytochromes and cupredoxins) to the catalytic subunit, NorB, which contains the active site for NO reduction . This electron transfer function is essential for the enzymatic reduction of nitric oxide to nitrous oxide during denitrification. The standard cNOR is composed of two subunits - NorC and NorB - though certain thermophilic bacteria like Thermus species contain a third subunit (NorH), which appears to play an important role in high-temperature environments .

How does norC differ structurally from other components of the nitric oxide reductase complex?

While NorB (the catalytic subunit) contains 12 transmembrane helices and binds three metal centers (a low-spin heme b and a binuclear active site), norC has a much simpler structure with a single N-terminal transmembrane anchor connected to a periplasmic domain containing a c-type heme . The heme c in norC has a midpoint potential of approximately 310 mV, which is intermediate between the potentials of the low-spin heme b (345 mV) and the active site heme b₃ (60 mV) in NorB . This potential gradient facilitates efficient electron flow from external donors through norC to the catalytic center in NorB. The structural arrangement of norC relative to NorB ensures proper orientation for optimal electron transfer between the protein subunits.

What is the physiological significance of the recently discovered third subunit (NorH) in thermophilic bacteria?

In Thermus species and thermophilic Aquificales, the nor cluster contains a third gene (norH) that encodes a small membrane protein. Recent research has demonstrated that NorH associates with norC and NorB in vivo, forming a three-subunit complex. Functional studies indicate that NorH is required for efficient denitrification at high temperatures . This additional subunit likely confers thermostability to the enzyme complex or optimizes its activity under thermal stress conditions. The conservation of norH across different thermophilic bacterial genera suggests an important adaptive role for this subunit in high-temperature environments. This represents an evolutionary divergence from the two-subunit structure found in mesophilic denitrifiers, highlighting the specialized adaptations for nitric oxide reduction in thermophilic ecosystems.

What are the optimal expression systems for producing recombinant norC protein?

Both homologous and heterologous expression systems have been successfully employed for norC production, each with distinct advantages. Homologous expression in Thermus thermophilus yields authentic protein but with very low yields (approximately 0.04 mg from 1 L of culture) . In contrast, heterologous expression in E. coli can provide significantly higher yields—approximately 20 times greater than those achieved in the native host .

For successful expression in E. coli, two additional plasmids are essential: pEC86, which contains genes required for cytochrome c assembly, and pRARE, which carries tRNA genes necessary for reading rare codons . Without the pEC86 plasmid, the heme c component is absent from the expressed norC, and the subunit is unstable and present in lower amounts, as evidenced by SDS-PAGE analysis . This underscores the critical importance of proper heme incorporation for stable norC production.

What purification strategies yield the highest purity and activity of recombinant norC?

Affinity chromatography using a His-tag placed on the C-terminus of the associated NorB subunit has proven effective for purifying the complete cNOR complex, including the norC subunit . For recombinant norC expressed as part of NoRC complexes, immunoaffinity chromatography with α-myc antibodies can be used when the protein is tagged with a Myc epitope . Alternative approaches involve co-expression with Flag-tagged partner proteins followed by anti-Flag antibody precipitation.

A typical purification protocol includes:

  • Initial separation on ion exchange columns such as BioRex70

  • Affinity capture using appropriate antibodies

  • Washing with medium-salt buffer (e.g., EX-500)

  • Elution with specific peptides (e.g., 200 μg/ml of Flag or myc peptide in EX-300 buffer)

This multi-step process ensures high purity while maintaining the native association between norC and its partner subunits, which is crucial for preserving enzymatic activity.

How can researchers verify the proper assembly of heme c into recombinant norC?

Verification of proper heme c incorporation into norC can be accomplished through several complementary techniques:

  • SDS-PAGE combined with heme staining: This method reveals the presence of covalently attached heme c in the norC subunit .

  • Spectroscopic analysis: The reduced-minus-oxidized spectrum of properly assembled norC shows characteristic peaks at approximately 553 nm (heme c) and 560 nm (low-spin heme b), with the 553 nm peak indicating successful incorporation of heme c .

  • Activity assays: Functional electron transfer capability depends on proper heme incorporation, so measuring electron transfer rates from various donors can indirectly confirm correct assembly.

  • Mass spectrometry: This can verify the presence of covalently attached heme groups and confirm the exact molecular weight of the mature protein.

The absence of the 553 nm spectral peak and reduced intensity of the norC band in SDS-PAGE following expression without the pEC86 plasmid provides strong evidence that heme c incorporation is essential for stable norC production .

What methods are used to measure nitric oxide reductase activity in recombinant norC-containing complexes?

Nitric oxide reductase activity is typically measured using an NO-sensing electrode that detects the consumption of NO in reaction mixtures. The assay conditions frequently include:

  • Temperature considerations: While the optimal growth temperature for thermophilic organisms like T. thermophilus is around 75°C, activity assays are often performed at lower temperatures (e.g., 42°C) due to limitations of the NO-sensing electrode .

  • Electron donors: Various electron donors can be used, including:

    • TMPD (N,N,N′,N′-tetramethyl-p-phenylenediamine) at concentrations of 0.5-2.5 mM

    • PMS (phenazine methosulfate) at about 10 μM

    • Cytochrome c552 (30 μM) in combination with TMPD (0.5 mM)

  • Controls: The addition of KCN (100 μM) completely inhibits enzyme activity, providing a useful negative control to verify that the observed NO consumption is enzyme-dependent .

Activity is typically expressed as electrons per minute (e⁻/min) or as a percentage relative to a reference condition (often TMPD-driven activity is set as 100%) .

How do different electron donors affect the measured activity of recombinant norC-containing enzyme complexes?

Different electron donors show varying effectiveness in driving nitric oxide reductase activity, as demonstrated in the following table derived from studies of T. thermophilus cNOR:

Electron donorsk cat (e⁻/min)n% Activity
TMPD 2.5 mM5.5 ± 0.515100
PMS 10 μM9 ± 0.75163
cyt c552 30 μM + TMPD 0.5 mM2.5146

Data are expressed as average ± SD of n independent experiments .

PMS shows the highest activity (163% relative to TMPD), likely because it can donate electrons directly to the active site in the NorB subunit, bypassing the electron relay function of norC . The combination of cytochrome c552 and TMPD shows reduced activity (46% relative to TMPD alone), suggesting potential competition or rate-limiting steps in the electron transfer pathway. These differential activities with various electron donors provide insights into the electron transfer mechanisms within the enzyme complex.

How do site-directed mutations in the norC-NorB complex affect enzyme functionality?

While most reported mutations focus on the catalytic NorB subunit rather than norC itself, these studies provide valuable insights into the functional interactions within the complex. Key findings include:

  • Mutations of E211, which coordinates the non-heme iron (FeB) in the binuclear center:

    • E211D and E211Q mutants retain approximately 34% of wild-type activity

    • E211A mutant maintains 68% of wild-type activity, suggesting the glutamate ligand to FeB is not absolutely essential

  • Mutations of histidine ligands to FeB:

    • H259N mutation completely abolishes activity, indicating the critical importance of this histidine coordination

  • Mutations of E280, which forms a hydrogen bond with E211:

    • E280D and E280Q mutants retain about 30% activity

    • E280M mutant is completely inactive

  • Mutations of E215, which contributes to the electronegative environment of the binuclear center:

    • E215D and E215Q mutants retain 31% and 56% of wild-type activity, respectively

These findings highlight the differential sensitivity of the enzyme to various amino acid substitutions and provide insights into the structural features essential for nitric oxide reduction.

How can recombinant norC be used as a model system to study electron transfer mechanisms in membrane proteins?

Recombinant norC serves as an excellent model system for investigating electron transfer in membrane proteins due to several advantageous characteristics:

  • Defined electron transfer pathway: The electron flow from external donors through norC's heme c to the binuclear center in NorB follows a clear pathway with measurable intermediate steps. This allows researchers to study the kinetics and thermodynamics of each electron transfer event.

  • Spectroscopic accessibility: The distinct spectral signatures of different heme centers (norC's heme c at 553 nm and NorB's heme b at 560 nm) enable researchers to monitor electron distribution throughout the complex using UV-visible spectroscopy .

  • Modular architecture: The separable domains of norC (membrane anchor and periplasmic heme domain) allow for structure-function analysis of specific protein regions through truncation or chimeric constructs.

  • Established mutation system: The well-documented effects of various mutations on activity provide a foundation for further targeted studies of electron transfer determinants .

By systematically varying electron donors, mutating key residues, and employing rapid kinetic techniques, researchers can use recombinant norC to elucidate fundamental principles governing electron transfer across biological membranes, with potential applications to other redox-active membrane protein systems.

What role does norC play in the ecological significance of nitric oxide reduction in environmental systems?

NorC plays a crucial role in the global nitrogen cycle through its contribution to denitrification pathways. Recent research has highlighted several important ecological aspects:

  • Greenhouse gas production: Incomplete denitrification, potentially due to suboptimal norC function, leads to the release of N₂O, a powerful greenhouse gas implicated in climate change . Studies at the Great Boiling Spring in the US Great Basin have attributed high ambient N₂O emissions to incomplete denitrification by Thermus thermophilus and related bacterial species .

  • Thermal adaptation: The presence of the additional norH subunit in thermophilic bacteria suggests specialized adaptations of the norC-containing complex for functioning in extreme environments . This adaptation may influence nitrogen cycling in geothermal habitats.

  • Metabolic flexibility: The ability of norC-containing enzymes to utilize various electron donors indicates metabolic versatility in different environmental conditions , potentially allowing denitrifying organisms to adapt to changing redox environments.

Understanding norC function in diverse organisms provides insights into microbial contributions to nitrogen cycling and greenhouse gas emissions, with potential applications in developing strategies for mitigating N₂O release from natural and engineered systems.

How do the structural and functional properties of norC in thermophilic bacteria differ from those in mesophilic organisms?

Thermophilic bacteria like Thermus thermophilus exhibit several distinctive adaptations in their norC-containing nitric oxide reductases compared to mesophilic counterparts:

  • Additional subunit: The presence of the norH gene encoding a small membrane protein represents a major structural difference in thermophilic systems. This third subunit is associated with the cNOR in vivo and is required for efficient denitrification at elevated temperatures .

  • Temperature optima: While the nitric oxide reductase activity of T. thermophilus cNOR cannot be measured at its physiological optimum (75°C) due to technical limitations, the enzyme shows activity at 42°C with various electron donors . This indicates thermal stability not typically found in mesophilic enzymes.

  • Expression challenges: The expression and assembly of functional thermophilic norC in mesophilic hosts present challenges, reflected in the requirement for specialized plasmids (pEC86 and pRARE) when expressing in E. coli .

  • Conservation patterns: The norH gene is conserved across thermophilic Aquificales in addition to Thermus species, suggesting convergent evolution or horizontal gene transfer of this adaptation for nitric oxide reduction at high temperatures .

These differences highlight evolutionary adaptations that enable denitrification to proceed efficiently under thermophilic conditions, providing insights into the molecular basis of thermal adaptation in redox enzymes.

What factors should be considered when designing experiments to characterize norC-containing complexes?

When designing experiments for norC-containing complexes, researchers should consider several critical factors:

  • Expression system selection:

    • For maximum yield: Heterologous expression in E. coli with pEC86 and pRARE plasmids (approximately 20× higher yield than homologous expression)

    • For native properties: Homologous expression in original organisms like T. thermophilus

  • Temperature considerations:

    • Growth temperature: Optimal growth temperature for the source organism (e.g., 75°C for T. thermophilus)

    • Assay temperature: Technical limitations may necessitate performing assays at lower temperatures (e.g., 42°C)

    • Enzyme stability: Assess stability at various temperatures to determine optimal handling conditions

  • Electron donor selection:

    • For maximum activity: PMS (phenazine methosulfate) at ~10 μM (163% relative activity)

    • For physiological relevance: cytochrome c552 (though activity is lower)

    • For comparison with literature: TMPD at 2.5 mM (standardized reference)

  • Controls and verification:

    • Negative control: KCN (100 μM) for complete inhibition

    • Spectroscopic verification: Confirm proper heme incorporation by reduced-minus-oxidized spectrum

    • SDS-PAGE with heme staining: Verify subunit composition and heme presence

Careful consideration of these factors ensures reliable characterization of norC-containing complexes and facilitates comparison with published studies.

What spectroscopic techniques are most informative for characterizing recombinant norC?

Several spectroscopic techniques provide valuable insights into different aspects of norC structure and function:

  • UV-visible spectroscopy:

    • Reduced-minus-oxidized difference spectra reveal characteristic peaks for heme c (553 nm) and heme b (560 nm)

    • Allows monitoring of heme incorporation and oxidation state

    • Can track electron transfer kinetics in real-time

  • Electron paramagnetic resonance (EPR):

    • Detects paramagnetic centers including ferric heme and non-heme iron

    • Provides information about the electronic structure and coordination environment of metal centers

    • Can distinguish between different heme types based on g-values

  • Resonance Raman spectroscopy:

    • Probes the vibrational modes of heme and its coordination environment

    • Can detect subtle changes in heme structure upon mutation or ligand binding

    • Helps determine the spin and coordination state of heme iron

  • Fourier-transform infrared (FTIR) spectroscopy:

    • Useful for studying NO binding and reduction at the active site

    • Can detect intermediates in the catalytic cycle

    • Provides insights into protein conformational changes during catalysis

These complementary techniques, when used in combination, provide a comprehensive characterization of norC structure, heme environment, electron transfer properties, and catalytic mechanism.

How can researchers troubleshoot common problems in recombinant norC expression and activity assays?

Researchers working with recombinant norC may encounter several challenges. Here are troubleshooting strategies for common issues:

  • Low expression yield:

    • Verify presence of pEC86 (cytochrome c assembly) and pRARE (rare codons) plasmids for E. coli expression

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Consider using specialized E. coli strains designed for membrane protein expression

    • Try fusion tags that enhance membrane protein folding and stability

  • Improper heme incorporation:

    • Confirm reduced-minus-oxidized spectrum shows the characteristic 553 nm peak for heme c

    • Verify heme presence by heme staining after SDS-PAGE

    • Supplement growth medium with δ-aminolevulinic acid to enhance heme biosynthesis

    • Ensure anaerobic conditions during expression to prevent heme oxidation

  • Low enzyme activity:

    • Test multiple electron donors (PMS shows highest activity at 163% relative to TMPD)

    • Verify inhibition by KCN (100 μM) to confirm that observed activity is enzyme-dependent

    • Optimize buffer conditions (pH, ionic strength, glycerol content)

    • Check for the presence of all required subunits by SDS-PAGE

  • Temperature sensitivity during assays:

    • For thermophilic variants, maintain proteins at moderate temperatures (~42°C) to balance enzyme stability with technical limitations of NO sensors

    • Include stabilizing agents (glycerol, sucrose) in assay buffers

    • Perform time-course experiments to detect activity loss over time

By systematically addressing these potential issues, researchers can improve the reliability and reproducibility of experiments involving recombinant norC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.