Recombinant Nitrobacter hamburgensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Interactions

Subunit a interacts with other ATP synthase components, as shown by STRING network analysis :

Interacting SubunitGeneFunction
F1 subcomplex alphaatpARegulatory subunit of ATP synthase catalytic core
F1 subcomplex betaatpDCatalytic site for ATP synthesis
F0 subcomplex CatpEProton channel component
F1 subcomplex gammaatpGRegulates ATPase activity and proton flow

Research Applications

This recombinant protein is utilized in:

  • Mechanistic Studies: Investigating ATP synthase assembly and proton translocation .

  • Enzyme Engineering: Modifying ATP synthase for biotechnological applications .

  • Structural Biology: Crystallization or cryo-EM studies to resolve F0 sector architecture .

Comparative Genomic Insights

Whole-genome analyses of N. hamburgensis highlight:

  • Plasmid Diversity: Three plasmids encode unique genes for heavy metal resistance and conjugation, absent in other Nitrobacter species .

  • Metabolic Flexibility: Chromosomal genes enable mixotrophic growth, including pathways for aromatic compound catabolism .

  • Pseudogene Enrichment: ~20% of the genome consists of pseudogenes, suggesting recent evolutionary adaptation .

Significance in Nitrification

As a chemolithoautotroph, N. hamburgensis oxidizes nitrite to nitrate for energy. ATP synthase subunit a enables energy conservation in this process, linking nitrification to cellular ATP production . Genomic studies suggest lateral gene transfer events may have shaped its unique metabolic traits .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
atpB; Nham_0269; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
atpB
Target Protein Sequence
MMDPIHQFNIETIFTIGHIGGQEIAFTNSSAYMLVAVVLTSLLMLATGRKLVPGRMQSIA EISYEFVADTIHTTAGKDGMKFFPFVFTIFMLVTVSNLVGIVPYTFTISSHIIVTAALAF LVFFTVLIYGFYKNGLRFFKLFVPSGIPIVILPLVVAIEVISFLSRPVSHSVRLFANMLA GHITLKVFASFVTMLGAMGIVGVFGAVLPLALVVALTALELLVAFLQAYVFTILTCIYIN DAIHPGH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Nitrobacter hamburgensis differ genomically from other Nitrobacter species, particularly regarding ATP synthesis?

Nitrobacter hamburgensis X14 possesses a complex genome consisting of one chromosome (4.4 Mbp) and three plasmids (294, 188, and 121 kbp), with over 20% of the genome composed of pseudogenes and paralogs . Comparative genomic analysis with other Nitrobacter species such as N. winogradskyi and Nitrobacter sp. strain Nb-311A reveals that N. hamburgensis harbors many unique genes related to energy metabolism.

While core ATP synthase genes are conserved across Nitrobacter species, N. hamburgensis contains several unique genes encoding additional energy conservation systems, including:

  • Distinctive heme-copper oxidases not found in other Nitrobacter species

  • Cytochrome b561, which may provide additional electron transport pathways

  • A complete glycolysis pathway absent in N. winogradskyi

  • Expanded metabolic versatility through pathways for catabolism of aromatic, organic, and one-carbon compounds

These genomic differences likely contribute to N. hamburgensis's enhanced mixotrophic capabilities, allowing it to achieve higher growth rates in media containing both nitrite and organic carbon compared to other Nitrobacter species that predominantly rely on chemolithoautotrophic metabolism .

What expression systems are most effective for producing recombinant N. hamburgensis atpB protein?

The most commonly documented expression system for recombinant N. hamburgensis ATP synthase subunit a (atpB) is Escherichia coli . This heterologous expression approach effectively produces the full-length protein (amino acids 1-247) with an N-terminal His-tag. When working with membrane proteins like atpB, several methodological considerations should be addressed:

  • Vector selection: pET-based expression vectors with T7 promoters provide tightly controlled, high-level expression suitable for membrane proteins.

  • E. coli strain optimization: BL21(DE3) derivatives with modifications to reduce toxicity from membrane protein overexpression are preferred. Strains like C41(DE3) or C43(DE3) often yield better results for ATP synthase components.

  • Induction parameters: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) during induction minimize inclusion body formation.

  • Membrane extraction: Efficient extraction requires specialized detergents like n-dodecyl β-D-maltoside (DDM) or digitonin to maintain structural integrity.

The resulting recombinant protein typically achieves greater than 90% purity as determined by SDS-PAGE and can be stored as a lyophilized powder or in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For reconstitution, the protein should be dissolved in deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol addition for long-term storage at -20°C/-80°C .

How does atpB function within the broader metabolic context of Nitrobacter hamburgensis?

ATP synthase subunit a (atpB) plays a crucial role within N. hamburgensis's unique metabolic framework. This bacterium operates as a facultative chemolithoautotroph that derives energy primarily from the oxidation of nitrite to nitrate via nitrite oxidoreductase (NXR) . The ATP synthase complex containing the atpB subunit serves as the terminal component in this energy conservation pathway.

The metabolic context surrounding atpB function includes:

Metabolic ProcessRelationship to ATP SynthesisUnique Features in N. hamburgensis
Nitrite oxidationPrimary energy sourceContains multiple copies of NXR genes in the "subcore" genome
Carbon fixationConsumer of ATPContains a 28-kb "autotrophic island" with RuBisCO and other Calvin cycle enzymes
Electron transportGenerates proton motive forcePossesses unique cytochromes and heme-copper oxidases
Mixotrophic growthSupplemental energy sourceComplete glycolysis pathway and expanded organic compound metabolism

The atpB protein functions within this system by facilitating proton translocation across the membrane, coupling the proton motive force generated by nitrite oxidation to ATP synthesis. Unlike purely autotrophic Nitrobacter species, N. hamburgensis can achieve higher growth rates when utilizing both nitrite and organic carbon sources, suggesting potential regulatory adaptations in how ATP synthase components respond to different energy sources .

What are the challenges in purifying functional recombinant atpB protein and how can they be overcome?

Purifying functional recombinant ATP synthase subunit a (atpB) presents several distinct challenges due to its hydrophobic nature as a membrane protein. Researchers should consider the following methodological approaches to overcome these barriers:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Consider using amphipathic polymers like SMA to extract native lipid environment

    • Optimize temperature and time during solubilization (typically 4°C for 1-2 hours)

  • Purification strategy:

    • Implement two-step purification with IMAC followed by size exclusion chromatography

    • Use cobalt resins instead of nickel for higher specificity with His-tagged proteins

    • Add low concentrations of detergent throughout purification to prevent aggregation

    • Consider adding lipids during purification to stabilize the protein structure

  • Quality assessment:

    • Verify purity using SDS-PAGE (should exceed 90%)

    • Assess structural integrity via circular dichroism to confirm alpha-helical content

    • Perform thermal shift assays to identify optimal buffer conditions

  • Storage optimization:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and avoid repeated freeze-thaw cycles

    • Add 5-50% glycerol for long-term storage at -20°C/-80°C

Researchers should also consider utilizing the latest membrane protein characterization techniques, such as native mass spectrometry or cryo-electron microscopy, to verify the structural integrity of the purified atpB protein. These approaches can provide valuable insights into the protein's native conformation and potential interactions with other ATP synthase subunits.

What evolutionary insights can be gained from studying N. hamburgensis atpB in relation to other Nitrobacter species?

Evolutionary analysis of ATP synthase subunit a (atpB) across Nitrobacter species provides remarkable insights into bacterial adaptation and metabolic specialization. The Nitrobacter "subcore" genome analysis has identified 116 genes unique to the genus, with ATP synthase components representing key elements of this evolutionary signature .

Several evolutionary patterns emerge from comparative analysis:

  • Horizontal gene transfer (HGT) signatures: Many Nitrobacter subcore genes, potentially including atpB, have diverged significantly from, or have origins outside, the alphaproteobacterial lineage . This suggests acquisition through HGT events that may have contributed to the specialized nitrite-oxidizing capacity.

  • Adaptive evolution at functional interfaces: The atpB protein contains regions that interact with other ATP synthase subunits and with the membrane environment. Sequence analysis across Nitrobacter species reveals higher conservation in subunit interaction domains and greater divergence in membrane-spanning regions, reflecting adaptation to different membrane compositions.

  • Metabolic specialization correlation: The evolution of atpB appears to parallel the broader metabolic differentiation observed among Nitrobacter species. N. hamburgensis shows expanded mixotrophic capabilities compared to N. winogradskyi, with corresponding specializations in energy conservation mechanisms .

  • Plasmid-chromosome gene transfer: While most ATP synthase components are chromosomally encoded, the presence of a 28-kb "autotrophic island" conserved across Nitrobacter species but located on different replicons (plasmid in N. hamburgensis, chromosome in others) suggests ongoing genetic reorganization in this genus . This dynamic genomic architecture likely influences the evolution of energy conservation genes including atpB.

These evolutionary patterns provide context for understanding how N. hamburgensis has optimized its ATP synthase complex for its specific ecological niche and metabolic capabilities.

How can directed evolution approaches be applied to enhance atpB functionality for biotechnological applications?

Directed evolution of N. hamburgensis atpB offers promising avenues for enhancing ATP synthase functionality in biotechnological applications. This methodological approach can target specific improvements in stability, activity, or substrate specificity through iterative processes of mutagenesis and selection. A comprehensive directed evolution strategy should include:

  • Library generation methodologies:

    • Error-prone PCR with controlled mutation rates (2-5 mutations per kb)

    • Site-saturated mutagenesis targeting transmembrane domains or proton channel residues

    • DNA shuffling with atpB homologs from other extremophilic bacteria

    • CRISPR-based in vivo continuous evolution systems

  • Selection strategies:

    • Growth-coupled selection in minimal media requiring ATP synthesis

    • Fluorescent protein fusions for monitoring membrane integration

    • ATP-sensing reporter systems for high-throughput screening

    • Proton gradient sensitive dyes for functional screening

  • Target properties for enhancement:

    PropertyEnhancement GoalPotential Application
    ThermostabilityIncrease tolerance to 45-60°CBiofuel production processes
    pH toleranceFunction at pH 4.5-6.0Acidic fermentation environments
    Coupling efficiencyImprove ATP/proton ratioEnhanced bioenergetic systems
    Expression level3-5 fold increase in membrane integrationOverproduction of ATP in engineered systems
    Detergent stabilityMaintain function in various detergentsImproved purification yields
  • Validation methodologies:

    • Reconstitution in proteoliposomes to measure proton pumping activity

    • Structural analysis of successful variants using cryo-EM

    • In vivo metabolic analysis of engineered strains

    • Long-term stability testing under application-relevant conditions

This approach could yield atpB variants with enhanced functionality for applications in bioelectrochemical systems, ATP regeneration systems for cell-free synthetic biology, and engineered microorganisms for specific biocatalytic processes requiring robust energy generation.

What insights does the atpB genomic context provide about the adaptation of N. hamburgensis to various ecological niches?

The genomic context of atpB in Nitrobacter hamburgensis provides fascinating insights into this organism's adaptation to diverse ecological niches. Unlike obligate chemolithoautotrophs, N. hamburgensis demonstrates remarkable metabolic flexibility, and the genomic arrangement surrounding atpB reflects this adaptability.

Analysis of the N. hamburgensis genome reveals several key adaptations:

  • Metabolic flexibility encoding: The presence of both autotrophic and heterotrophic pathways surrounding energy conservation genes creates a genomic architecture supporting mixotrophic growth. The chromosome harbors unique genes for heme-copper oxidases, cytochrome b561, and pathways for catabolism of aromatic, organic, and one-carbon compounds adjacent to core energy metabolism genes . This arrangement facilitates rapid switching between energy sources in fluctuating environments.

  • Horizontal gene acquisition signatures: Many genes in the Nitrobacter "subcore" genome, including those related to energy conservation, show evidence of divergence from alphaproteobacterial lineages or acquisition from outside this lineage . This suggests that adaptation to nitrite oxidation involved substantial horizontal gene transfer.

  • Plasmid-chromosome distribution: The presence of a 28-kb "autotrophic island" on the largest plasmid of N. hamburgensis (compared to chromosomal location in other Nitrobacter species) suggests ongoing genetic reorganization . This dynamic genomic architecture likely provides evolutionary flexibility for adaptation to new niches.

  • Regulatory network integration: The genomic context reveals integration between nitrite oxidation pathways, carbon fixation mechanisms, and ATP synthesis components. The presence of PII-like regulators in the Nitrobacter subcore genome suggests sophisticated regulatory networks coordinating energy generation with carbon assimilation across different environmental conditions.

These genomic adaptations explain N. hamburgensis's ability to thrive in environments with fluctuating nitrite and organic carbon availability, such as wastewater treatment systems, eutrophic water bodies, and soil-water interfaces. The strategic positioning of atpB within this genomic framework highlights its central role in the metabolic versatility that defines N. hamburgensis ecology.

What are the optimal conditions for expressing and purifying functional recombinant atpB protein?

Successful expression and purification of functional recombinant N. hamburgensis ATP synthase subunit a (atpB) requires careful optimization of multiple parameters. Based on established protocols and membrane protein biochemistry principles, the following methodological approach is recommended:

Expression Optimization:

ParameterOptimal ConditionsRationale
Expression hostE. coli C41(DE3) or C43(DE3)Specialized strains for membrane protein expression
Growth temperature30°C until induction, 18°C post-inductionReduces inclusion body formation
Induction OD₆₀₀0.6-0.8Optimal cell density for membrane protein expression
Inducer concentration0.1-0.2 mM IPTGLower concentrations reduce toxicity
Post-induction time16-18 hoursExtended time allows proper membrane integration
Media composition2xYT with 1% glucose pre-inductionGlucose represses basal expression

Purification Protocol:

  • Cell disruption:

    • Resuspend cells in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 10% glycerol, 1 mM PMSF

    • Disrupt by sonication or French press at 4°C

    • Remove unbroken cells by centrifugation (10,000×g, 20 min, 4°C)

  • Membrane isolation:

    • Ultracentrifuge supernatant (100,000×g, 1 hour, 4°C)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization:

    • Resuspend membrane in solubilization buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol)

    • Add 1% DDM or 1% digitonin, stir gently for 1 hour at 4°C

    • Ultracentrifuge (100,000×g, 30 min, 4°C) to remove insoluble material

  • Affinity purification:

    • Apply supernatant to Ni-NTA or TALON resin

    • Wash with 20-50 mM imidazole

    • Elute with 250-300 mM imidazole

  • Size exclusion chromatography:

    • Apply concentrated sample to Superdex 200 column

    • Elute with buffer containing 0.05% DDM or digitonin

Final storage conditions should include Tris/PBS-based buffer with 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Aliquot to avoid repeated freeze-thaw cycles.

How can researchers effectively reconstitute atpB into functional proteoliposomes for bioenergetic studies?

Reconstitution of purified N. hamburgensis ATP synthase subunit a (atpB) into proteoliposomes represents a critical methodology for investigating its bioenergetic functions. This process requires careful optimization to create functional proteoliposomes that maintain native protein activity.

Step-by-Step Reconstitution Protocol:

  • Lipid preparation:

    • Create a lipid mixture mimicking bacterial membranes (70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin)

    • Dissolve lipids in chloroform, evaporate under nitrogen, and desiccate under vacuum

    • Hydrate to 10 mg/mL in reconstitution buffer (20 mM HEPES, 100 mM KCl, pH 7.5)

    • Subject to 5 freeze-thaw cycles using liquid nitrogen

  • Liposome sizing:

    • Extrude through 400 nm polycarbonate filters (10 passes)

    • Further extrude through 200 nm filters (15 passes)

    • Verify size distribution using dynamic light scattering

  • Protein incorporation:

    • Destabilize liposomes with detergent (typically 0.1-0.5% Triton X-100)

    • Add purified atpB protein at lipid:protein ratio of 50:1 to 100:1

    • Incubate with gentle agitation for 30 minutes at room temperature

  • Detergent removal:

    • Add Bio-Beads SM-2 in sequential additions:

      • 30 mg/mL, incubate 2 hours at room temperature

      • 30 mg/mL, incubate overnight at 4°C

      • 60 mg/mL, incubate 2 hours at room temperature

    • Alternatively, use dialysis against detergent-free buffer with frequent changes

  • Proteoliposome harvesting:

    • Centrifuge at 100,000×g for 1 hour at 4°C

    • Resuspend pellet in fresh reconstitution buffer

    • Store at 4°C for immediate use or flash-freeze in liquid nitrogen

Functional Validation Assays:

  • Proton pumping assay:

    • Incorporate pH-sensitive fluorescent dye (ACMA) into proteoliposomes

    • Monitor fluorescence quenching upon addition of ATP or establishment of membrane potential

  • ATP synthesis measurement:

    • Generate ΔpH and membrane potential using valinomycin and pH jump

    • Measure ATP formation over time using luciferase assay

  • Patch-clamp electrophysiology:

    • Form GUVs (giant unilamellar vesicles) from proteoliposomes

    • Perform patch-clamp recording to measure proton conductance through atpB

These methodologies enable detailed bioenergetic characterization of atpB function, providing insights into proton translocation mechanisms and coupling efficiency with other ATP synthase components.

What are the most common technical challenges when working with recombinant atpB and how can they be resolved?

Researchers working with recombinant N. hamburgensis ATP synthase subunit a (atpB) encounter several technical challenges due to its hydrophobic nature, complex structure, and functional requirements. Below are common challenges and their methodological solutions:

  • Poor expression yields

    Challenge: Membrane proteins like atpB often express poorly in heterologous systems.

    Solutions:

    • Optimize codon usage for expression host

    • Test multiple promoter strengths (T7, trc, ara)

    • Evaluate fusion partners (MBP, SUMO) to enhance solubility

    • Consider cell-free expression systems for toxic membrane proteins

    • Implement Lemo21(DE3) or other tunable expression systems

  • Protein misfolding and aggregation

    Challenge: Hydrophobic membrane proteins frequently misfold and form inclusion bodies.

    Solutions:

    • Reduce expression temperature to 16-18°C

    • Add chemical chaperones (glycerol, sucrose) to growth media

    • Co-express molecular chaperones (GroEL/ES, DnaK)

    • Use specialized E. coli strains like SHuffle or Origami for disulfide bond formation

    • Consider partial solubilization from inclusion bodies and refolding

  • Inefficient membrane extraction

    Challenge: Complete extraction of membrane-embedded atpB without denaturation.

    Solutions:

    • Screen multiple detergents systematically (DDM, LMNG, digitonin, CHAPS)

    • Optimize detergent:protein ratio and solubilization time

    • Consider styrene-maleic acid (SMA) copolymers for native lipid co-extraction

    • Test two-step solubilization with mild followed by stronger detergents

    • Add lipids during solubilization to stabilize protein structure

  • Limited functional activity

    Challenge: Maintaining the functional activity of isolated atpB.

    Solutions:

    • Add specific lipids (cardiolipin, phosphatidylethanolamine) during purification

    • Maintain physiological pH (typically 7.5-8.0) throughout isolation

    • Avoid metal chelators in buffers as ATP synthase requires Mg²⁺

    • Minimize exposure to high salt concentrations

    • Use anaerobic conditions during purification to prevent oxidative damage

  • Storage instability

    Challenge: Rapid activity loss during storage.

    Solutions:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add 5-50% glycerol for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles by creating single-use aliquots

    • Consider lyophilization with appropriate cryoprotectants

    • For extended stability, reconstitute into proteoliposomes or nanodiscs

By systematically addressing these challenges using the recommended methodological approaches, researchers can significantly improve their success in working with recombinant N. hamburgensis atpB for structural and functional studies.

What potential exists for engineering N. hamburgensis atpB for enhanced bioenergetic applications?

N. hamburgensis atpB holds considerable potential for engineering enhanced bioenergetic applications due to the unique adaptations this protein has evolved for energy conservation in a nitrite-oxidizing chemolithoautotroph. Several promising engineering directions include:

  • Bioelectrochemical systems optimization:

    • Engineering atpB for improved electron transfer coupling with electrodes

    • Developing hybrid systems where nitrite oxidation is coupled to electricity generation

    • Creating biosensors for nitrite detection based on ATP synthase activity

  • Biofuel production enhancement:

    • Modifying atpB for operation in reverse mode to improve hydrogen production

    • Engineering strains with enhanced ATP synthase efficiency for improved biofuel yields

    • Creating ATP synthase variants with reduced proton leakage for higher energy conservation

  • Environmental bioremediation:

    • Optimizing atpB function in extremes of pH and temperature for diverse remediation settings

    • Engineering enhanced coupling with denitrification pathways for complete nitrogen removal

    • Developing immobilized systems with optimized ATP synthase for continuous bioremediation

  • Synthetic biology platforms:

    • Incorporating engineered atpB into minimal synthetic cells as power generators

    • Creating modular ATP generation systems for cell-free biotechnology

    • Designing novel proton circuits utilizing modified atpB components

Specific engineering targets for atpB modification include:

Engineering TargetModification ApproachPotential Application
Proton channel efficiencyModify key residues in transmembrane helicesEnhanced ATP synthesis efficiency
Detergent resistanceIncrease hydrophobic interactions at subunit interfacesImproved protein stability in artificial systems
Temperature rangeIntroduce thermostable adaptations from extremophilesOperation in high-temperature bioprocesses
Redox couplingEngineer direct electron transfer capabilitiesElectrode-coupled bioenergetic systems
Substrate specificityModify ion selectivity of the proton channelCreate Na⁺-driven ATP synthases for alkaline environments

These engineering directions could significantly expand the application range of N. hamburgensis atpB in sustainable biotechnology and bioenergy production systems.

How might systems biology approaches enhance our understanding of atpB function within the cellular context?

Systems biology approaches offer powerful frameworks for understanding N. hamburgensis atpB function beyond isolated biochemical characterization, providing insights into its integrated role within the cellular metabolic network. Several methodological strategies can significantly advance our understanding:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to map atpB regulation under varying energy sources

    • Identify key regulatory networks controlling ATP synthase expression during transitions between autotrophic and mixotrophic growth

    • Characterize post-translational modifications of atpB under different physiological conditions

  • Flux balance analysis (FBA):

    • Develop genome-scale metabolic models incorporating ATP synthase kinetics

    • Predict optimal ATP synthase activity under different nutrient limitations

    • Identify critical flux distributions that constrain energy conservation efficiency

  • Protein interaction networks:

    • Map the complete interactome of atpB using techniques like BioID or proximity labeling

    • Characterize dynamic interactions during assembly of the ATP synthase complex

    • Identify previously unknown regulatory proteins interacting with atpB

  • Metabolic control analysis:

    • Determine flux control coefficients for atpB within the complete energy generation pathway

    • Identify rate-limiting steps in ATP synthesis under different growth conditions

    • Calculate elasticity coefficients to understand how atpB responds to changes in proton motive force

  • In silico modeling approaches:

    • Develop agent-based models of ATP synthase assembly and function

    • Create molecular dynamics simulations of proton translocation through atpB

    • Model the co-evolution of atpB with other components of bioenergetic pathways

These systems approaches could resolve key questions about N. hamburgensis metabolism, such as:

  • How does atpB expression coordinate with nitrite oxidoreductase under fluctuating nitrite conditions?

  • What metabolic adaptations occur when cells transition between chemolithoautotrophic and mixotrophic growth?

  • How does ATP synthase activity balance with the requirements of carbon fixation and nitrogen metabolism?

  • What regulatory mechanisms fine-tune ATP synthesis rate to match cellular energy demands?

By applying these systems biology methodologies, researchers can develop a more comprehensive understanding of atpB's role within the complex metabolic network of N. hamburgensis.

What are the implications of N. hamburgensis atpB structure-function relationships for the broader field of bioenergetics?

The structure-function relationships of N. hamburgensis ATP synthase subunit a (atpB) hold significant implications for advancing fundamental knowledge in bioenergetics. As a component of ATP synthase in a metabolically versatile nitrite oxidizer, atpB offers unique perspectives on evolutionary adaptations of energy conservation mechanisms.

Several key implications emerge from the study of this system:

  • Evolutionary diversity of proton translocation mechanisms:
    N. hamburgensis atpB represents an adaptation to a specialized ecological niche, demonstrating how proton translocation mechanisms have evolved in response to specific bioenergetic constraints. The alphaproteobacterial lineage shows significant divergence in ATP synthase components , suggesting multiple evolutionary solutions to similar bioenergetic challenges. Comparing these variations provides insights into the fundamental principles governing proton-coupled ATP synthesis across domains of life.

  • Interface between electron transport and ATP synthesis:
    The unique electron transport components in N. hamburgensis, including specialized heme-copper oxidases and cytochrome b561 , create distinctive interfaces with ATP synthase. Understanding how these components coordinate with atpB advances our knowledge of how electron transport chains and ATP synthases have co-evolved to optimize energy conservation under different metabolic modes.

  • Mechanistic insights into proton channeling:
    Structural analysis of atpB can reveal specific adaptations in proton channeling pathways that enable function within the membrane environment of a nitrite oxidizer. These insights contribute to resolving fundamental questions about the molecular mechanics of proton translocation, including:

    • How specific residues create unidirectional proton pathways

    • The role of water molecules in facilitating proton movement

    • Conformational changes that couple proton translocation to rotary catalysis

  • Mixed metabolic mode adaptations:
    N. hamburgensis's capacity for both chemolithoautotrophic and mixotrophic growth suggests potential regulatory mechanisms affecting ATP synthase operation under different energy regimes. The atpB structural features may reveal adaptations that allow rapid switching between metabolic modes, providing broader insights into bioenergetic flexibility in bacteria.

  • Convergent evolution in energy conservation:
    The presence of genes with origins outside the alphaproteobacterial lineage in the Nitrobacter subcore genome suggests historical horizontal gene transfer events that shaped its bioenergetic systems. This highlights convergent evolutionary solutions to energy conservation challenges and provides a framework for understanding the limits and possibilities of ATP synthase adaptation.

These implications extend beyond N. hamburgensis biology to inform broader questions in bioenergetics, evolutionary biochemistry, and the fundamental principles governing cellular energy transduction across all domains of life.

How should researchers integrate current knowledge of N. hamburgensis atpB to design comprehensive experimental approaches?

Researchers seeking to design comprehensive experimental approaches involving N. hamburgensis ATP synthase subunit a (atpB) should integrate current knowledge across multiple dimensions of this system. A holistic experimental framework should encompass:

  • Comparative genomic foundation:
    Begin with genomic context analysis, recognizing that atpB exists within a specialized genomic environment that includes unique energy conservation components and metabolic pathways . This should inform experimental design by considering potential interactions with other components unique to Nitrobacter.

  • Multidisciplinary methodological integration:
    Combine structural biology, biochemistry, and systems approaches through a coordinated experimental pipeline:

    a. Express and purify recombinant atpB using optimized protocols for membrane proteins
    b. Perform structural characterization through cryo-EM or advanced NMR techniques
    c. Reconstitute into proteoliposomes for functional studies
    d. Develop in vivo reporter systems to monitor activity in cellular context
    e. Apply systems biology approaches to understand regulatory networks

  • Ecological context consideration:
    Design experiments that reflect the ecological niche of N. hamburgensis, incorporating:

    a. Variable nitrite concentrations mimicking natural environments
    b. Transitions between autotrophic and mixotrophic conditions
    c. pH and temperature ranges relevant to soil and wastewater habitats
    d. Co-culture systems with ammonia oxidizers to create complete nitrification

  • Technological platform development:
    Create specialized tools for studying this challenging membrane protein:

    a. Develop fluorescent protein fusions that maintain atpB functionality
    b. Establish inducible expression systems for controlled studies
    c. Design biosensors for monitoring ATP synthase activity in real-time
    d. Create genetic manipulation systems optimized for Nitrobacter species

  • Translational perspective:
    Structure experiments to bridge fundamental knowledge with potential applications:

    a. Screen for conditions enhancing ATP synthesis efficiency
    b. Evaluate performance in bioelectrochemical systems
    c. Assess stability under conditions relevant to bioremediation
    d. Test compatibility with synthetic biology frameworks

This integrated approach recognizes that N. hamburgensis atpB represents not merely an isolated protein but a component evolved within a specialized metabolic framework for nitrite oxidation and energy conservation. By designing experiments that reflect this complexity, researchers can gain deeper insights into both the fundamental biology of this system and its potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.