Recombinant Nitrobacter hamburgensis ATP synthase subunit b/b' (atpG)

What is the structural and functional role of ATP synthase subunit b/b' in Nitrobacter hamburgensis?

ATP synthase subunit b/b' (atpG) in Nitrobacter hamburgensis functions as a critical component of the F-type ATP synthase complex, specifically within the membrane-embedded FO module. This 185-amino acid protein (UniProt Q1QRI0) serves as part of the peripheral stalk that connects the F1 catalytic domain to the FO proton channel domain.

Methodologically, the function can be determined through:

• Comparative genomic analysis with other bacterial ATP synthases

• Mutagenesis studies targeting conserved regions

• Protein-protein interaction assays with other ATP synthase subunits

The protein's sequence (MADSHGNAKGATAHTEAGGGHKAPFPPFQKDTFASQLVSLTIAFVALYLISSRLALPRVR KTIDDRQNKIEGDIAQAQTLKNESDAALKAYEVELAAARTRAQAIGNETREKLNAEADTE RKALEKRLSAKLADAEKTIASTRTAAMSNVRGIASDAATAIVQQLTGAMPDRKLVDSAVE ASMKG) contains functional domains typical of peripheral stalk components .

How does the genomic context of atpG differ in Nitrobacter hamburgensis compared to other nitrifying bacteria?

The atpG gene in N. hamburgensis is chromosomally encoded (locus Nham_0267) within the organism's 4.4 Mbp chromosome. Unlike some other nitrifying bacteria that have multiple copies of ATP synthase genes, current evidence indicates N. hamburgensis contains only a single copy of atpG .

For genomic context analysis:

• Map the position of atpG relative to other ATP synthase genes

• Compare with synteny of ATP operons in related species

• Analyze the promoter regions for unique regulatory elements

N. hamburgensis has a larger genome with more pseudogenes and paralogs (20% of its genome) compared to other Nitrobacter species, which may impact the evolution and regulation of its ATP synthase components. This is in contrast to other nitrifiers like N. oceani which contains two copies of genes necessary to assemble functional ATP synthase complexes .

What are the essential sequence features of N. hamburgensis atpG for proper function?

The 185-amino acid sequence of N. hamburgensis atpG contains several critical features that determine its functionality:

• N-terminal region: Contains hydrophobic segments for membrane anchoring

• Central region: Features coiled-coil domains for dimerization and stalk formation

• C-terminal region: Contains residues for interaction with F1 sector subunits

Researchers should focus on:

• Analyzing the conservation of key amino acid residues across related species

• Identifying potential post-translational modification sites

• Examining the hydrophobicity profile to predict membrane-spanning regions

Experimental approaches to determine critical sequences include alanine scanning mutagenesis, truncation studies, and cross-linking assays with interacting ATP synthase components .

What expression systems are most effective for producing recombinant N. hamburgensis atpG?

For optimal expression of recombinant N. hamburgensis atpG, researchers should consider:

Bacterial expression systems:

• E. coli BL21(DE3): Most commonly used, but may require optimization for membrane protein expression

• E. coli C41/C43: Engineered strains better suited for membrane protein expression

• Rhodopseudomonas strains: Closely related to Nitrobacter and may provide better folding environments

Expression optimization strategies:

• Use lower induction temperatures (16-25°C)

• Test various induction concentrations

• Consider fusion tags that enhance solubility (MBP, SUMO)

• Supplement growth media with specific ions (Mg2+)

• Co-express with chaperones

The expression of membrane-associated ATP synthase components often requires specialized approaches to avoid protein aggregation and ensure proper folding .

What purification challenges are specific to N. hamburgensis atpG, and how can they be addressed?

Purification of N. hamburgensis atpG presents several specific challenges:

Common challenges:

• Membrane association requiring detergent solubilization

• Potential for aggregation during concentration

• Co-purification of other ATP synthase components

Methodological solutions:

• Detergent screening protocol:

  • Test mild detergents (DDM, LMNG, digitonin)

  • Determine critical micelle concentration for each

  • Evaluate protein stability in each detergent by size exclusion chromatography

• Purification strategy:

  • Immobilized metal affinity chromatography using histidine tags

  • Ion exchange chromatography to separate from contaminants

  • Size exclusion chromatography for final polishing

• Buffer optimization:

  • Include stabilizing additives (glycerol 10-20%)

  • Maintain optimal pH (typically 7.0-8.0)

  • Include ATP/Mg2+ (2mM) to enhance stability

For maximum stability during storage, a Tris-based buffer with 50% glycerol at -20°C is recommended, avoiding repeated freeze-thaw cycles .

How can researchers verify the proper folding and functionality of purified recombinant atpG?

Verification of proper folding and functionality requires multiple complementary approaches:

Structural integrity assessments:

• Circular dichroism spectroscopy to analyze secondary structure content

• Thermal shift assays to determine stability

• Limited proteolysis to probe for exposed flexible regions

• Size exclusion chromatography to confirm monodispersity

Functional assays:

• In vitro reconstitution with other ATP synthase subunits

• Protein-protein interaction assays with partner subunits

• Integration into liposomes followed by proton pumping assays

Practical workflow:

• First assess purity by SDS-PAGE

• Follow with biophysical characterization

• Conduct reconstitution experiments

• Perform functional assays

Mass spectrometry can provide definitive confirmation of proper expression and identify any post-translational modifications or truncations .

How can recombinant N. hamburgensis atpG contribute to understanding ATP synthase assembly mechanisms?

Recombinant N. hamburgensis atpG serves as an excellent model for investigating ATP synthase assembly:

Experimental approaches:

• Sequential assembly studies:

  • Purify individual subunits (α, β, γ, δ, ε, and b/b')

  • Determine the order of assembly by adding components sequentially

  • Use native mass spectrometry to identify intermediate complexes

• Co-expression systems:

  • Design plasmids for co-expression of multiple ATP synthase subunits

  • Compare assembly efficiency with sequential addition

  • Identify assembly factors specific to Nitrobacter

• Nucleotide requirements:

  • Test assembly with ATP vs. non-hydrolyzable analogs (ADP, AMP-PNP)

  • Determine if nucleotide binding rather than hydrolysis is sufficient

Current research indicates that ATP/Mg2+ is essential for complex assembly, but interestingly, ATP hydrolysis is not required; mere nucleotide binding appears to be the critical factor triggering in vitro complex formation .

What insights can comparative analysis of N. hamburgensis atpG provide about ATP synthase evolution in chemolithoautotrophs?

Comparative analysis of N. hamburgensis atpG offers unique evolutionary insights:

Analytical approaches:

• Phylogenetic analysis:

  • Compare atpG sequences across nitrifying bacteria, other chemolithoautotrophs, and heterotrophs

  • Identify lineage-specific adaptations

  • Trace horizontal gene transfer events

• Structural comparison:

  • Model the 3D structure using homology modeling

  • Compare with known structures from other bacteria

  • Identify unique features that may relate to chemolithoautotrophic lifestyle

• Genomic context:

  • Analyze the organization of ATP synthase genes in N. hamburgensis

  • Compare with gene arrangements in related species

  • Identify unique regulatory elements

This protein belongs to the "Nitrobacter subcore" genome (116 genes) that distinguishes Nitrobacter from its closest relatives like Bradyrhizobium japonicum and Rhodopseudomonas palustris. Many of these subcore genes have diverged significantly from, or have origins outside, the alphaproteobacterial lineage, potentially indicating unique requirements for energy conservation during nitrite oxidation .

How does the function of ATP synthase in N. hamburgensis relate to its nitrite oxidation capabilities?

The relationship between ATP synthase and nitrite oxidation in N. hamburgensis involves sophisticated energy coupling:

Research methodologies:

• Bioenergetic profiling:

  • Measure proton motive force generated during nitrite oxidation

  • Quantify ATP synthesis rates under varying nitrite concentrations

  • Determine P/O ratios (ATP produced per oxygen consumed)

• Inhibitor studies:

  • Use specific ATP synthase inhibitors to determine effects on nitrite oxidation

  • Compare with effects of electron transport chain inhibitors

  • Establish the dependency of nitrite oxidation on ATP synthesis

• Mutational analysis:

  • Create point mutations in key atpG residues

  • Measure effects on both ATP synthesis and nitrite oxidation

  • Identify residues critical for energy coupling

Nitrite oxidation by N. hamburgensis generates a proton motive force across the membrane, which is utilized by ATP synthase for ATP production. This energy conservation strategy is critical for this chemolithoautotroph, which oxidizes nitrite to nitrate as its primary energy source .

What are common pitfalls in working with recombinant N. hamburgensis atpG and how can they be overcome?

When working with recombinant N. hamburgensis atpG, researchers frequently encounter several challenges:

Challenge 1: Low expression yields

• Solution: Optimize codon usage for the expression host

• Solution: Test different promoter strengths and induction conditions

• Solution: Consider fusion partners that enhance expression (SUMO, MBP)

Challenge 2: Protein aggregation

• Solution: Express at lower temperatures (16-20°C)

• Solution: Screen detergents systematically for membrane extraction

• Solution: Add stabilizing agents (glycerol, specific ions)

Challenge 3: Lack of interaction with other ATP synthase subunits

• Solution: Ensure presence of ATP/Mg2+ (2mM) during reconstitution

• Solution: Verify protein folding before interaction studies

• Solution: Consider co-expression with partner subunits

Challenge 4: Storage instability

• Solution: Store at -20°C in 50% glycerol

• Solution: Avoid repeated freeze-thaw cycles

• Solution: Prepare working aliquots for 4°C storage (up to one week)

How can researchers distinguish between functional and non-functional forms of recombinant atpG?

Distinguishing functional from non-functional forms requires multiple analytical approaches:

Structural analysis techniques:

• Circular dichroism (CD) spectroscopy:

  • Compare spectra with known functional protein

  • Analyze secondary structure content percentages

  • Monitor thermal denaturation profiles

• Size exclusion chromatography coupled with multi-angle light scattering:

  • Determine oligomeric state

  • Identify aggregation

  • Confirm homogeneity

Functional assays:

• Binding studies with partner subunits:

  • Surface plasmon resonance to measure binding kinetics

  • Microscale thermophoresis to determine binding affinities

  • Pull-down assays to confirm interactions

• Reconstitution experiments:

  • Assembly with other purified ATP synthase components

  • Measurement of ATP synthesis or hydrolysis in reconstituted system

  • Proton pumping assays in proteoliposomes

Properly folded and functional atpG should demonstrate specific binding to other ATP synthase components and contribute to ATP synthesis activity in reconstituted systems .

What advanced biophysical techniques are most informative for characterizing N. hamburgensis atpG structure-function relationships?

Several advanced biophysical techniques provide critical insights into atpG structure-function relationships:

Structural techniques:

• Cryo-electron microscopy:

  • Visualize atpG in the context of the ATP synthase complex

  • Identify interaction interfaces with other subunits

  • Determine conformational changes during catalytic cycle

• Hydrogen-deuterium exchange mass spectrometry:

  • Map solvent-accessible regions

  • Identify flexible domains

  • Monitor conformational changes upon binding partners

• Cross-linking coupled with mass spectrometry:

  • Identify proximity relationships between subunits

  • Map interacting surfaces

  • Validate structural models

Functional techniques:

• Single-molecule FRET:

  • Monitor real-time conformational changes

  • Measure dynamics during ATP synthesis

  • Correlate structural changes with functional states

• Atomic force microscopy:

  • Measure mechanical properties

  • Visualize topography at near-atomic resolution

  • Probe unfolding pathways

• Nanopore electrophysiology:

  • Measure ion conductance

  • Determine proton translocation rates

  • Characterize membrane integration

How should researchers design experiments to compare N. hamburgensis atpG with homologs from other bacteria?

When comparing N. hamburgensis atpG with homologs, a systematic experimental design is essential:

Experimental design framework:

• Sequence-based comparison:

  • Perform multiple sequence alignments with diverse bacterial homologs

  • Calculate conservation scores for each position

  • Identify lineage-specific substitutions

• Expression and purification strategy:

  • Express all homologs using identical systems

  • Purify under identical conditions

  • Characterize using the same analytical techniques

• Functional comparison:

  • Measure binding affinities to partner subunits

  • Compare stability under varying conditions

  • Test complementation in heterologous systems

Data analysis approach:

• Use statistical methods to identify significant differences

• Correlate sequence differences with functional variations

• Map differences onto structural models to identify potential mechanistic effects

The N. hamburgensis genome contains unique genes related to energy conservation compared to other Nitrobacter species, making cross-species comparisons particularly informative about specialized adaptations .

What criteria should be used to evaluate the quality of recombinant N. hamburgensis atpG preparations?

Quality assessment of recombinant atpG should include the following criteria and methodologies:

Additional considerations:

• Confirm absence of contaminating proteins

• Verify no significant truncations

• Ensure sample is free of aggregates

• Document batch-to-batch reproducibility

How do environmental factors affect ATP synthase function in N. hamburgensis, and how can this be studied using recombinant atpG?

Environmental factors significantly influence ATP synthase function in N. hamburgensis, with recombinant atpG serving as a valuable tool for mechanistic studies:

Key environmental factors:

Research methodologies:

• In vitro reconstitution:

  • Reconstitute ATP synthase with recombinant components

  • Test function under varying pH, ion concentrations, and temperatures

  • Compare with native enzyme behavior

• Liposome/proteoliposome studies:

  • Incorporate recombinant atpG into liposomes

  • Establish artificial proton gradients

  • Measure ATP synthesis under controlled conditions

• Correlation with nitrite oxidation:

  • Combine nitrite oxidation assays with ATP synthesis measurements

  • Determine stoichiometry between nitrite oxidized and ATP produced

  • Identify rate-limiting steps in energy conservation

These studies are particularly relevant as N. hamburgensis is a facultative chemolithoautotroph that must adapt its energy conservation mechanisms to varying environmental conditions .