Recombinant Nitrobacter hamburgensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

The mechanosensitive channel of large conductance (MscL) found in bacteria functions as an emergency valve that releases cytoplasmic solutes when the cell experiences osmotic stress . Inappropriate opening of the MscL pore can harm the cell, leading to speculation that it could be a potential target for antibiotics . One such MscL is found in Nitrobacter hamburgensis.

Nitrobacter hamburgensis

Nitrobacter hamburgensis X14 is a Gram-negative, facultative chemolithoautotroph that derives energy from the oxidation of nitrite to nitrate . The genome of N. hamburgensis X14 consists of a chromosome (4.4 Mbp) and three plasmids (294, 188, and 121 kbp) . Over 20% of this genome is made up of pseudogenes and paralogs .

Notably, N. hamburgensis can continue to oxidize nitrite in cultures containing up to 400 mM NaCl, but its nitrite oxidation is completely inhibited by 600 mM NaCl .

MscL and Antibiotic Targets

MscL is one of the most studied mechanosensitive channels, but no chemicals have been identified that influence bacterial growth by modulating MscL . Researchers have used high-throughput screening to identify compounds that slow growth in an MscL-dependent manner . Two sulfonamide compounds were characterized in one such screen. While both increase MscL gating, one does not function through the folate pathway, unlike other antimicrobial sulfonamides, and its only mode of action appears to be MscL activation .

MscL Activation and Structure

The binding pocket of MscL is located where an α-helix runs along the cytoplasmic membrane and interacts with a neighboring subunit; analogous motifs have been observed in several prokaryotic and eukaryotic channels . The region of the MscL protein that interacts with proteins and lipids at the cytoplasmic-lipid interface, where the S1 helix runs along the membrane, is of particular interest . Structures similar to this are found in other channels, such as the bacterial inward rectifying K+ channel KirBac, transient receptor potential (TRP) channels, 2-pore domain K+ (K2P) channels, and MscS, another bacterial mechanosensitive channel from an independent channel family . Disrupting normal interactions in this region could increase the gating of the MscL channel .

Compounds and MscL Activity

Patch clamp experiments have confirmed that these compounds increase channel activity . Eco-MscL channel activity increased significantly when compound 011 was presented from either the periplasm or the cytoplasm . Compound 120 also significantly increased MscL channel activity when presented from the periplasm, but had no significant effect from the cytoplasm, suggesting that compounds 011 and 120 have different modes of action, and that compound 011 works on either side of the bacterial membrane .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Nham_2261; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
mscL
Target Protein Sequence
MLKEFREFAMKGNVVDLAVAVIIGAAFGAIVSSMVADVIMPIIGAVTGGLDFSNYFTGLS KTVTATNLADAKKQGAVLAWGNFLTLTLNFLIVAFVLFMVVRFMSKLKRKDEAAPAAPPK PTREEELLTEIRDLLKTKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Nitrobacter hamburgensis MscL?

N. hamburgensis MscL shares the conserved structural elements typical of bacterial MscL channels, including an amphipathic helix (S1) at the N-terminus located on the cytoplasmic side of the membrane, two transmembrane helices (TM1 and TM2), and a cytosolic helix at the C-terminus . The transmembrane helices are connected by a large periplasmic loop, with additional connecting loops between the cytoplasmic helical bundle and the bottom of TM2 . The pore is lined by TM1 from each subunit in the multimeric complex .

The TM1 helix from each monomer interacts with two TM1 helices from adjacent monomers and two TM2 helices, creating a structure where the helices are tilted from the plane of the bilayer. This arrangement facilitates a pore-opening mechanism resembling a camera iris . When fully open, the non-selective pore reaches an estimated diameter of approximately 30 Å, resulting in a conductance of approximately 3 nS .

How does the genome structure of Nitrobacter hamburgensis influence its MscL properties?

The N. hamburgensis genome is significantly larger than other Nitrobacter species, containing approximately 1.6 Mbp more genetic material than N. winogradskyi . This expanded genome contributes to greater genetic versatility, including numerous pseudogenes and paralogs that may influence channel expression patterns .

N. hamburgensis possesses three plasmids (pPB11, pPB12, and pPB13), with the largest (pPB13) showing bias toward carbon/energy metabolism (28 genes) and information storage/processing functions . This genetic architecture may provide unique regulatory elements that affect MscL expression under various environmental conditions, potentially leading to functional differences compared to MscL channels from other bacterial species.

What are the primary physiological roles of MscL in Nitrobacter hamburgensis?

MscL in N. hamburgensis, like in other bacteria, serves as a critical emergency release valve that opens in response to increased turgor pressure when it approaches the lytic limit of the cellular membrane . This protective mechanism allows the cell to release cytoplasmic contents and reduce internal pressure, thereby preventing cell lysis during osmotic downshock.

N. hamburgensis displays significant halotolerance, with the ability to continue oxidizing nitrite in cultures containing up to 400 mM NaCl, though activity is completely inhibited at 600 mM NaCl . The MscL channel likely plays a crucial role in this osmotic stress response, working in concert with other osmoregulatory systems to maintain cellular integrity under changing environmental conditions.

What are the optimal expression systems for recombinant N. hamburgensis MscL?

For recombinant expression of N. hamburgensis MscL, E. coli-based expression systems have proven effective, particularly those designed specifically for membrane protein expression . When selecting an expression system, researchers should consider:

  • Expression Strain Selection: E. coli strains specifically designed for efficient membrane protein expression provide higher yields and proper folding. Recent studies have employed PELDOR spectroscopy to verify correct folding of MscL when expressed in these specialized strains .

  • Vector Design: Expression vectors should contain appropriate promoters (T7 or tac) and fusion tags (His6 or Strep-tag II) to facilitate purification while minimizing interference with channel function.

  • Induction Conditions: Optimal expression typically requires lower induction temperatures (16-20°C) and moderate inducer concentrations to prevent aggregation and formation of inclusion bodies.

  • Membrane Fraction Isolation: Careful isolation of membrane fractions through differential centrifugation is critical for maintaining channel integrity during purification.

What purification strategies yield functional recombinant N. hamburgensis MscL?

Purification of functionally active recombinant N. hamburgensis MscL requires a careful approach to maintain protein stability and native conformation:

  • Detergent Selection: Mild detergents such as n-Dodecyl β-D-maltoside (DDM) or n-Decyl-β-D-Maltopyranoside (DM) are preferred for membrane solubilization, as they effectively extract the channel while preserving its functional state.

  • Affinity Chromatography: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs represents the primary purification step, typically followed by size exclusion chromatography to ensure homogeneity.

  • Buffer Optimization: Purification buffers should contain glycerol (10-15%) and appropriate concentrations of detergent to prevent aggregation and maintain stability during purification.

  • Quality Assessment: Functional integrity following purification should be verified through techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or PELDOR spectroscopy, which can confirm proper folding and structural transitions .

How can patch-clamp electrophysiology be optimized for N. hamburgensis MscL characterization?

Patch-clamp electrophysiology represents a gold standard technique for functional characterization of MscL channels. For N. hamburgensis MscL, the following methodological considerations are crucial:

  • Reconstitution Methods: For optimal electrophysiological recordings, the purified channel should be reconstituted into lipid bilayers or liposomes composed of E. coli total lipid extract or synthetic mixtures mimicking bacterial membranes (typically containing phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin).

  • Patch Configuration: Inside-out patch configuration is typically employed, allowing direct control of membrane tension through application of negative pressure to the patch pipette.

  • Tension Calibration: Careful calibration of applied tension is essential for determining tension thresholds. The pressure threshold for N. hamburgensis MscL activation should be measured relative to that of endogenous channels (e.g., MscS) if present in the expression system.

  • Conductance Measurements: When fully open, MscL channels exhibit a large conductance of approximately 3 nS . Multiple subconductance states may be observed during partial opening events and should be carefully documented.

  • Data Analysis: Analysis should focus on key parameters including pressure threshold for activation, open probability as a function of applied tension, dwell times in various conductance states, and inactivation characteristics following sustained tension.

What spectroscopic methods are most informative for studying conformational changes in recombinant N. hamburgensis MscL?

Several spectroscopic approaches have proven valuable for investigating conformational changes in MscL channels:

  • PELDOR Spectroscopy: This technique allows for high-resolution distance measurements between spin-labeled sites in the protein, enabling researchers to follow folding and conformational changes . For N. hamburgensis MscL, site-directed spin labeling of introduced cysteine residues, particularly in the transmembrane domains, provides insights into channel dynamics during gating.

  • ESEEM Spectroscopy: Electron spin echo envelope modulation spectroscopy complements PELDOR by providing information about the local environment of spin labels, useful for characterizing expanded states of the channel .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique reveals regions of the protein that undergo changes in solvent accessibility during conformational transitions, helping to identify key structural elements involved in channel gating .

  • Fluorescence Resonance Energy Transfer (FRET): By introducing fluorescent labels at strategic positions, FRET can monitor real-time conformational changes in response to membrane tension or chemical modulators.

Spectroscopic MethodInformation ObtainedSample Preparation ConsiderationsResolution Level
PELDOR SpectroscopyDistance measurements between specific residuesRequires site-directed spin labeling2-8 nm distances
ESEEM SpectroscopyLocal environment of specific residuesRequires site-directed spin labelingAtomic-level interactions
HDX-MSSolvent accessibility changesMinimal modification requiredPeptide-level resolution
FRETReal-time conformational dynamicsRequires fluorescent labeling1-10 nm distances

Which key residues in N. hamburgensis MscL should be targeted for mutagenesis studies?

Based on comparative genomic and functional studies, several regions of the N. hamburgensis MscL are particularly important targets for mutagenesis:

  • TM1 Pore-Lining Residues: Mutations in the hydrophobic residues lining the pore constriction site often result in gain-of-function phenotypes, with hydrophilic substitutions typically lowering the tension threshold for activation . These residues are critical for maintaining the closed state of the channel.

  • TM2 Functional Residues: High-throughput screening has identified TM2 as functionally significant, with numerous loss-of-function mutations localized to this domain . Targeted mutagenesis of these residues can provide insights into the coupling between membrane tension sensing and pore opening.

  • Transmembrane Pocket Residues: Residues at the entrance of lipid-accessible transmembrane pockets are particularly interesting targets, as modifications at these positions (such as the L89W mutation or sulfhydryl modifications) can destabilize the closed state by hindering the penetration of lipid acyl chains into these pockets .

  • Interfacial Residues: Hydrophobic residues at the end of TM1 and TM2 are critical for channel function, with hydrophilic substitutions potentially eliminating tension responsiveness .

How can chemical modifications be used to modulate N. hamburgensis MscL gating?

Chemical modifications provide powerful tools for controlling MscL gating and stabilizing specific conformational states:

  • Sulfhydryl Reagents: Introduction of cysteine residues at strategic positions followed by modification with sulfhydryl reagents can dramatically alter channel gating properties. For example, MTSSL spin labels attached to introduced cysteine residues can modulate channel function while simultaneously enabling spectroscopic measurements .

  • Hydrophilic/Hydrophobic Modifications: The attachment of hydrophilic moieties to residues in the pore constriction region typically facilitates channel opening, while hydrophobic modifications generally stabilize the closed state.

  • Photoswitchable Ligands: Azobenzene-based photoswitchable compounds attached to engineered cysteines allow light-controlled modulation of channel activity, providing temporal control over gating.

  • Metal-Binding Sites: Engineered metal-binding sites can enable metal ion-dependent modulation of channel activity, allowing researchers to manipulate gating through changes in metal ion concentration.

What is the role of lipid interactions in modulating N. hamburgensis MscL function?

Lipid-protein interactions critically influence MscL function through several mechanisms:

  • Bilayer Thickness Effects: Changes in membrane thickness can alter the hydrophobic mismatch between the transmembrane domains and the bilayer, affecting the energetics of channel opening. N. hamburgensis MscL function should be tested in membranes of varying thickness to determine optimal conditions.

  • Lipid Composition Influence: The presence of specific lipids, particularly anionic phospholipids and lipids that affect membrane curvature, can significantly impact channel function. Reconstitution experiments should systematically vary lipid composition to identify specific lipid-protein interactions.

  • Lipid-Accessible Pockets: Recent studies have highlighted the importance of lipid-accessible transmembrane pockets in MscL function . The penetration of lipid acyl chains into these pockets appears to stabilize the closed state, while hindering this interaction promotes channel opening.

  • Membrane Tension Distribution: The distribution of tension within the membrane depends on lipid composition and the presence of membrane-deforming components, which can alter the effective tension sensed by the channel.

How can molecular dynamics simulations inform our understanding of N. hamburgensis MscL gating?

Molecular dynamics (MD) simulations provide valuable insights into the atomic-level details of MscL gating mechanics:

  • Simulation of Tensioned Membranes: MD simulations of N. hamburgensis MscL in lipid bilayers under tension can be used to stabilize expanded states in response to mechanical stimuli, revealing intermediate conformational states and the dynamics of pore hydration .

  • Free Energy Calculations: Potential of mean force calculations can quantify the energetic barriers between different conformational states, providing insights into the energetics of channel gating.

  • Lipid-Protein Interaction Analysis: Simulations can identify specific lipid binding sites and quantify how lipid-protein interactions change during channel gating, informing experimental design for mutagenesis studies.

  • Water Permeation Pathways: Analysis of water permeation through the channel during simulations can reveal the formation of hydration pathways that precede full channel opening, identifying key residues that control hydration.

  • Comparison with Experimental Data: MD simulation results should be validated against experimental measurements from techniques such as PELDOR and HDX-MS to ensure accuracy of the computational models .

What strategies can be used to engineer N. hamburgensis MscL for biosensor applications?

The unique properties of MscL channels make them attractive candidates for biosensor development:

  • Site-Directed Modifications: Strategic introduction of cysteine residues for chemical modification can create channels that respond to specific analytes. For N. hamburgensis MscL, the identified transmembrane pockets offer promising targets for such modifications .

  • Gain-of-Function Mutations: Utilizing the extensive knowledge of gain-of-function mutations can create channels with altered gating thresholds and specificities. A systematic analysis of the effects of these mutations in N. hamburgensis MscL would be valuable for rational design of biosensors.

  • Fusion Protein Approaches: Fusion of sensing domains to strategic positions in MscL can create tension-coupled sensors, where binding of an analyte to the sensing domain induces conformational changes that modulate channel gating.

  • Readout System Development: For biosensor applications, development of appropriate readout systems is essential. Options include electrical detection (patch-clamp or planar lipid bilayer recordings), fluorescence-based methods (using membrane-impermeant fluorescent dyes), or coupling to reporter genes in cell-based assays.

What is known about the evolutionary relationships between N. hamburgensis MscL and other bacterial mechanosensitive channels?

Understanding the evolutionary context of N. hamburgensis MscL provides insights into structure-function relationships:

  • Comparison with Other Nitrobacter Species: Despite significant genomic differences between Nitrobacter species, core functional elements are highly conserved. N. hamburgensis has a much larger genome than other Nitrobacter species (~1.6 Mbp larger than N. winogradskyi), but many protein-coding genes show high similarity across species .

  • Relationship to Model MscL Channels: Comparative analysis with well-studied MscL channels from M. tuberculosis (TbMscL) and E. coli (EcMscL) reveals conserved functional elements alongside species-specific adaptations. This information can guide the selection of residues for mutagenesis studies.

  • Genomic Context and Regulation: Recent discoveries have linked MscL excretory activity to regulation by alternative ribosome-rescue factor (arfA) sRNA, connecting osmotic and translational stress responses . Investigation of similar regulatory mechanisms in N. hamburgensis could reveal unique adaptations.

  • Restriction-Modification Systems: N. hamburgensis encodes an above-average quantity of restriction-modification systems (11 systems, 2.39 RM genes per Mbp), primarily type II RM systems . These systems may have influenced the evolution of MscL by promoting homologous recombination and genomic rearrangements.

How can researchers address protein stability issues during purification of N. hamburgensis MscL?

Maintaining stability of membrane proteins during purification presents significant challenges:

  • Optimized Detergent Screening: Systematic screening of detergents beyond standard options (DDM, DM) should include newer amphipathic polymers like styrene-maleic acid copolymers (SMAs) that can extract membrane proteins with their native lipid environment intact.

  • Thermostability Assays: Implementing fluorescence-based thermal shift assays during purification optimization can rapidly identify conditions that enhance protein stability.

  • Stabilizing Mutations: Introduction of disulfide bridges or other stabilizing mutations based on comparative sequence analysis of MscL channels from extremophiles may enhance stability without compromising function.

  • Co-purification with Specific Lipids: Addition of specific lipids during purification, particularly those identified as important for channel function, can significantly improve stability and homogeneity of the purified protein.

What approaches can resolve discrepancies between in vitro and in vivo functional data for N. hamburgensis MscL?

Researchers often encounter differences between channel behavior in artificial systems versus native contexts:

  • Native Membrane Composition Analysis: Detailed lipidomic analysis of N. hamburgensis membranes can inform more physiologically relevant reconstitution conditions for in vitro studies.

  • Cell-Based Functional Assays: Development of cell-based assays that maintain the native membrane environment while allowing functional measurements can bridge the gap between in vitro and in vivo approaches.

  • Temperature and pH Optimization: Ensuring that in vitro experiments are conducted at conditions matching the physiological environment of N. hamburgensis (optimal growth at pH 7.6-8.0) is critical for meaningful comparisons.

  • Assessment of Post-Translational Modifications: Investigation of potential post-translational modifications in native MscL that may be absent in recombinant systems can explain functional discrepancies.

How can researchers accurately measure tension thresholds for N. hamburgensis MscL activation?

Precise determination of tension thresholds is fundamentally important yet technically challenging:

  • Calibrated Force Application: Development of systems for applying precisely calibrated forces to membranes, such as micropipette aspiration combined with patch-clamp recordings, provides more accurate measurements than relative pressures.

  • Standardized Reporting: Expressing activation thresholds relative to well-characterized channels (MscS or MscL from E. coli) facilitates comparison across studies and laboratories.

  • Membrane Composition Standardization: Establishing standard membrane compositions for reconstitution experiments ensures that variations in activation thresholds reflect properties of the channel rather than differences in membrane properties.

  • Single-Channel versus Population Measurements: Reconciling discrepancies between single-channel measurements and population-based assays (such as osmotic downshock survival) requires careful consideration of how channel properties at the single-molecule level translate to cellular responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.