Recombinant Nitrobacter hamburgensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Nitrobacter hamburgensis YidC (UniProt ID: Q1QH68) is a 609-amino-acid membrane insertase with a molecular weight of ~61 kDa . It belongs to the YidC/Oxa1/Alb3 family of proteins, which are essential for the co-translational integration of transmembrane proteins into lipid bilayers . Key features include:

  • Structure: Five transmembrane domains (TMs) forming a hydrophilic cavity accessible from the cytoplasm and lipid phase .

  • Function: Catalyzes the membrane insertion of Sec-independent substrates (e.g., phage proteins, ATP synthase subunits) and assists Sec-dependent substrates .

  • Expression: Produced in E. coli with an N-terminal His tag for purification .

Mechanism of Action

YidC operates via two pathways:

  • Sec-independent: Directly inserts small proteins (e.g., Pf3 coat protein) into membranes through a hydrophilic cavity at the lipid-protein interface .

  • Sec-YidC holocomplex: Collaborates with the Sec translocon for larger substrates, ensuring proper folding and lateral release into the bilayer .

Experimental studies show YidC’s catalytic efficiency, with up to 150 substrate molecules inserted per YidC molecule in vitro .

Key Functional Domains

  • TM2–TM3 helical hairpin: Critical for ribosomal interactions at the tunnel exit .

  • Hydrophilic cavity: Binds nascent membrane proteins via charged residues, enabling lipid partitioning .

Membrane Protein Biogenesis Studies

  • Substrate insertion assays: Used to reconstitute YidC-dependent integration mechanisms in proteoliposomes .

  • Structural modeling: Combined with cryo-EM and molecular dynamics to map ribosome-YidC interactions .

Antimicrobial Target Exploration

YidC is essential for bacterial viability . Downregulation via antisense RNA impairs growth in E. coli, validating its potential as a target for novel antibiotics . Synergistic effects with essential oils (eugenol, carvacrol) highlight therapeutic strategies .

Table 2: YidC Homologs Across Species

OrganismProteinRole
E. coliYidCSec-independent & Sec-dependent insertion
Mitochondria (Human)Oxa1Membrane protein assembly
Chloroplasts (Plants)Alb3Thylakoid membrane biogenesis

Product Availability and Usage

The recombinant YidC protein is commercially available as a lyophilized powder for experimental use . Key notes include:

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Applications: Functional assays, structural studies, and inhibitor screening .

Future Directions

Research gaps include elucidating substrate translocation through YidC’s hydrophilic cavity and leveraging its conserved mechanism for antibiotic development . The recombinant Nitrobacter hamburgensis YidC provides a tractable model for these studies, bridging evolutionary and mechanistic insights .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yidC; Nham_3703; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
yidC
Target Protein Sequence
MMSENRNTIIAIVLSGLILIAWQYFYNIPQMEKDRAAQQAQSQTAKSPTEPTPNSPKPDH PAAESVVARGVAIATTPRVKIDTPRLSGSISLKGARIDDLLLTKFRETVDPASPAIELFS PSGTTTPYYAEFGWVAATGSTARVPDQNTVWQQEGSGALTQSTPVTLKYDNGEGLTFRRT IAVDDHYLFTIKDEVTNAGGAPVTLYPFALISRHGTPAVSGYYILHEGLIGYLGDQKLQE YSYKKIDEAKSVSFKVTNGWLGITDKYWAAALLPDTSAQLQARFSSNESGSVKTYQADYL EDAQTIPVGGTGSVNTRLFAGAKEAGVVGINFPFVELGGYNKQLGLNHFDLLIDWGWFYF ITKPMFLALDFFFHVFGNFGIAILFVTVLIKAIFFPLANRSYASMAKMKAVQPQIAALKE RFPDDKMKLQQEMMEIYKKEKINPISGCLPMVLQIPVFFSLYKVLFVTIEMRHAPFFAWI KDLSAPDPTHIFNLFGLLPYDPSAVPLLGPYLAIGAWPIIMGITMWFQMKLNPTPPDPTQ KLIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELLNNVKSVFRR KSSDKPAKT
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrobacter hamburgensis YidC and what is its primary function?

Nitrobacter hamburgensis YidC is a membrane protein insertase that facilitates the insertion and folding of transmembrane proteins into cellular membranes. As part of the YidC/Oxa1/Alb3 protein family, this insertase is conserved across all domains of life, sharing homology with Alb3 in chloroplasts and Oxa1 in mitochondria . The primary function of YidC is to catalyze membrane protein insertion, overcoming the thermodynamically unfavorable passage of hydrophilic polypeptide residues through the hydrophobic core of the membrane . Research has directly confirmed that YidC functions as an independent insertase, capable of membrane protein insertion without requiring the Sec translocase system .

What is the structural composition of Nitrobacter hamburgensis YidC?

The full-length Nitrobacter hamburgensis YidC protein consists of 609 amino acids with multiple functional domains . Its structure includes:

DomainLocationFunction
Transmembrane (TM) grooveMembrane-spanning regionsEssential for high-affinity interaction with substrate proteins
Hydrophilic grooveWithin TM domainFacilitates protein transport across membrane bilayer
Periplasmic domain (PD)Extracellular regionPresent in Gram-negative bacteria but absent in Gram-positive counterparts
Cytoplasmic C2 loopIntracellular regionCritical for protein stabilization and function
α-helical hairpinCytoplasmic regionBinds substrate polypeptides during insertion process

The amino acid sequence includes a His-tag when expressed recombinantly, which facilitates purification and experimental manipulation of the protein .

How does N. hamburgensis YidC compare to YidC proteins from other bacterial species?

N. hamburgensis YidC shares core structural and functional properties with other bacterial YidC proteins but has specific features related to its Gram-negative bacterial origin:

  • Unlike YidC in Gram-positive bacteria, N. hamburgensis YidC contains a periplasmic domain that contributes to its function .

  • The C2 loop in N. hamburgensis YidC is critical for determining the protein's conformation and function, similar to its role in other Gram-negative bacteria .

  • The genome of N. hamburgensis contains this yidC gene as part of its core genetic makeup, along with other genes essential for nitrogen metabolism .

What are the key mechanistic steps in YidC-mediated membrane protein insertion?

YidC-mediated insertion involves a precisely coordinated series of molecular events:

StepTimeframeMolecular Events
Initial bindingWithin 2 msCytoplasmic α-helical hairpin of YidC binds the substrate polypeptide with high conformational variability and kinetic stability
Binding strengtheningWithin 52 msYidC strengthens binding to substrate and undergoes conformational changes
Transfer to membraneFollows bindingUses cytoplasmic α-helical hairpin domain and hydrophilic groove to transfer substrate to membrane
Insertion completionFinal stageSubstrate reaches membrane-inserted, folded state with low conformational variability

During this process, conformational changes in YidC's transmembrane domain and the membrane core have mechanistic effects on the substrate protein . Additionally, the hydration and dehydration of YidC's hydrophilic groove are critical during the insertion phase .

What role does the C2 loop play in Nitrobacter hamburgensis YidC function?

The C2 loop in N. hamburgensis YidC serves multiple critical functions:

The impact of eliminating the C2 loop on Gram-negative bacterial YidC is far more substantial than the effect of removing just the periplasmic domain, highlighting its structural and functional importance .

How do the transmembrane domains facilitate protein insertion?

The transmembrane domains of YidC contain specialized features that enable efficient protein insertion:

  • The YidC transmembrane groove is essential for high-affinity interaction with substrate proteins .

  • The hydrophilic nature of this groove plays a crucial role in facilitating protein transport across the cytoplasmic membrane bilayer to the periplasmic side .

  • During insertion, conformational changes in YidC's transmembrane domain mechanistically affect how substrate proteins are processed .

  • The groove provides a favorable environment for the passage of hydrophilic segments of substrate proteins through the hydrophobic membrane core, reducing the thermodynamic barrier .

What are the optimal conditions for expressing and purifying recombinant N. hamburgensis YidC?

Based on established protocols for recombinant N. hamburgensis YidC:

ParameterOptimal ConditionNotes
Expression systemE. coliSuccessfully used for recombinant expression
Protein tagN-terminal His tagFacilitates purification via affinity chromatography
Protein lengthFull length (1-609 aa)Maintains complete functional domains
Storage formLyophilized powderFor long-term stability
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein integrity
Storage temperature-20°C/-80°CWith recommended aliquoting to avoid freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdding 5-50% glycerol for long-term storage recommended

It's important to note that repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain protein activity .

What techniques are most effective for studying YidC-mediated membrane insertion in vitro?

Several complementary techniques have proven valuable for studying YidC function:

  • Single-molecule force spectroscopy - Allows direct measurement of forces involved in the insertion process and has been successfully combined with fluorescence spectroscopy to investigate how YidC facilitates membrane protein insertion .

  • Molecular dynamics (MD) simulations - Enable detailed analysis of protein behavior at the molecular level. Multiple models of YidC embedded in lipid bilayers can be constructed to characterize the roles of specific domains .

  • Equilibrium MD simulations - Provide insights into the significance of multiple domains of the YidC structure at a detailed molecular level .

  • Principal component analysis (PCA) - Identifies the most significant differences between wild-type and modified YidC systems, helping to understand the contributions of specific domains .

  • Steered molecular dynamics - Useful for investigating specific aspects of the insertion mechanism and protein-protein interactions .

How can researchers effectively study the interdomain coupling in N. hamburgensis YidC?

To study interdomain coupling in YidC:

  • Create multiple system models with specific domain deletions (e.g., YidC with PD region and C2 loop, YidC without C2 loop, YidC without PD region, and YidC without both PD region and C2 loop) .

  • Employ RMSD (root-mean-square deviation) analysis to assess conformational differences between these models .

  • Use principal component analysis focusing on specific regions (e.g., Cα atoms in the TM area) to identify significant variations in protein dynamics .

  • Analyze critical inter- and intradomain interactions that contribute to protein stability and function through molecular simulations .

  • Compare the behavior of wild-type and modified proteins to determine the allosteric influences between domains .

What are the key considerations when analyzing structural data for N. hamburgensis YidC?

When analyzing structural data for N. hamburgensis YidC, researchers should consider:

  • Native membrane environment effects - Crystal structures may not fully capture the protein's behavior in a lipid bilayer, necessitating additional membrane-based studies .

  • Dynamic properties - YidC undergoes significant conformational changes during function, particularly in the transmembrane domain and membrane core during substrate insertion .

  • Domain-specific functions - The hydrophilic groove, cytoplasmic α-helical hairpin, and periplasmic domains have distinct roles in the insertion mechanism .

  • Allosteric effects - Modifications to one domain (e.g., removal of the C2 loop) can have significant impacts on distant regions of the protein through allosteric mechanisms .

  • Comparison with homologous structures - Analysis of similarities and differences with other YidC proteins provides evolutionary and functional insights .

How should researchers interpret comparative genomic data for understanding YidC evolution?

When analyzing comparative genomic data for YidC proteins:

  • Examine the Nitrobacter "subcore" genome - This consists of 116 genes that remain after removing homologs found in strains of the closest evolutionary relatives (Bradyrhizobium japonicum and Rhodopseudomonas palustris) .

  • Identify key evolutionary patterns - Many of the subcore genes related to YidC function have diverged significantly from, or have origins outside, the alphaproteobacterial lineage .

  • Note genomic context - In N. hamburgensis, YidC exists within a genome comprised of one chromosome (4.4 Mbp) and three plasmids (294, 188, and 121 kbp) .

  • Consider plasmid-chromosome gene transfer - Some genes found on plasmids in one Nitrobacter species may be present on chromosomes in related species, indicating possible gene transfer events .

  • Analyze functional constraints - The conservation of specific domains across species reflects their functional importance in membrane protein insertion .

What are common challenges in working with recombinant N. hamburgensis YidC?

Common challenges and solutions include:

ChallengePossible Solutions
Protein aggregationStore as aliquots at -20°C/-80°C; avoid repeated freeze-thaw cycles; use appropriate buffer with 6% Trehalose, pH 8.0
Loss of activityReconstitute in deionized sterile water to 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage
Experimental variabilityEnsure purity greater than 90% as determined by SDS-PAGE; use consistent preparation methods
Membrane insertion difficultiesOptimize lipid composition to mirror native environment; ensure proper protein folding
Low expression yieldOptimize codon usage; use specialized expression systems for membrane proteins; express in E. coli

How can researchers optimize functional assays for studying YidC-mediated insertion?

To optimize functional assays:

  • Select appropriate substrate proteins - Model proteins like Pf3 coat protein have been successfully used in YidC studies and provide a good starting point .

  • Combine multiple techniques - Integrating single-molecule force spectroscopy with fluorescence spectroscopy and molecular dynamics simulations provides comprehensive insights into the insertion process .

  • Consider time-resolved measurements - The insertion process occurs in distinct phases (initial binding within 2 ms, strengthening within 52 ms), so time-resolved techniques are valuable for capturing these events .

  • Monitor conformational changes - Techniques that can detect changes in protein structure during the insertion process will provide mechanistic insights .

  • Validate in multiple systems - Compare results from in vitro reconstituted systems with in vivo studies to ensure physiological relevance .

What are promising future research directions for N. hamburgensis YidC?

Several promising research directions include:

  • Detailed investigation of the Sec-independent insertion mechanism for Gram-negative bacterial YidC, building on hypothetical models developed from current studies .

  • Further exploration of the critical inter- and intradomain interactions that contribute to protein stability and function, particularly those involving the C2 loop and periplasmic domain .

  • Comparative studies between Gram-negative and Gram-positive bacterial YidC to better understand the functional significance of the periplasmic domain .

  • Investigation of potential species-specific adaptations in N. hamburgensis YidC related to its ecological niche as a nitrite-oxidizing bacterium .

  • Development of improved expression and purification protocols to facilitate structural and functional studies of this challenging membrane protein .

How might research on N. hamburgensis YidC contribute to understanding broader biological questions?

Research on N. hamburgensis YidC can address several fundamental questions:

  • Universal mechanisms of membrane protein insertion - The presence of YidC homologues in all domains of life makes mechanistic insights broadly relevant for membrane protein biogenesis .

  • Evolutionary adaptation of protein translocation systems - Understanding how YidC functions in different bacterial species provides insights into evolutionary processes .

  • Structural basis of protein-lipid interactions - YidC studies reveal how proteins interact with membrane lipids during the insertion process .

  • Coordination between protein synthesis and membrane integration - YidC research helps elucidate how cells coordinate these complex processes .

  • Bacterial adaptation to specialized ecological niches - N. hamburgensis is a nitrite-oxidizing bacterium, and understanding its protein insertion machinery may reveal adaptations related to this lifestyle .

How does YidC research connect with studies of bacterial nitrogen metabolism?

N. hamburgensis is primarily known for its role in nitrite oxidation, and YidC research connects to this aspect in several ways:

  • N. hamburgensis conserves energy from the oxidation of nitrite to nitrate as a facultative chemolithoautotroph .

  • The proper insertion of membrane proteins involved in nitrogen metabolism likely depends on YidC function, making it an essential component of the cellular machinery supporting this metabolic process .

  • Within the N. hamburgensis genome, genes for nitrite oxidoreductase (NXR) and cytochromes associated with dissimilatory nitrite reductase (NirK) are found among the Nitrobacter subcore inventory, alongside genes for protein insertion machinery .

  • Understanding the insertion mechanism for membrane proteins may provide insights into how key enzymes involved in nitrogen cycling are assembled and maintained in bacterial membranes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.