Recombinant Nitrobacter hamburgensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant nuoK is typically produced via heterologous expression in E. coli. Key steps include:

Expression and Purification

StepDetailsSource
CloningnuoK gene cloned into expression vectors with His-tag for affinity purification
Expression ConditionsOptimized in E. coli at specific temperatures (e.g., 16–25°C)
PurificationNickel affinity chromatography followed by gel filtration
StorageLyophilized or stored at -20°C/-80°C in Tris-based buffer with 50% glycerol

Quality Control

  • Activity Validation: Assayed using NADH-ubiquinone reductase activity tests .

  • Purity: Confirmed via SDS-PAGE and Western blotting .

Biochemical Studies

Recombinant nuoK is used to study:

  1. Structural Interactions: Mapping quinone-binding cavities and Fe-S cluster coordination in Complex I .

  2. Proton Translocation: Mechanisms of coupling electron transfer to proton pumping .

  3. Inhibitor Sensitivity: Testing capsaicin-40 and other quinone analogs .

Immunological Tools

As a purified antigen, nuoK is employed in:

  • ELISA Kits: Detecting anti-nuoK antibodies in Nitrobacter hamburgensis studies .

  • Protein-Protein Interaction Assays: Identifying binding partners in Complex I .

Comparative Analysis with Other Bacterial nuoK Proteins

OrganismProduct CodeExpression RegionTagSource
Nitrobacter hamburgensisCSB-CF633282NAAF1–102 aaN-terminal His
Hydrogenobaculum sp.CB9156308751–100 aaN-terminal His
Anaeromyxobacter dehalogenansRFL5382AF1–99 aaN-terminal His

This table highlights conserved features across species, including His-tagging for purification and full-length expression .

Challenges and Future Directions

  • Functional Characterization: Limited studies on Nitrobacter hamburgensis nuoK necessitate further research into its role in nitrite-oxidizing metabolism .

  • Therapeutic Targets: Homologs in pathogenic bacteria (e.g., Vibrio cholerae) suggest potential for antimicrobial drug development targeting NQR complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please specify it for preferential development.
Synonyms
nuoK; Nham_2210; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
nuoK
Target Protein Sequence
MTIGLGHYLAVGAILFTLGILGIFLNRKNIIVILMSVELILLAVNINLVAFSAFLGDIVG QVFALLVLTVAAAEAAIGLAVLVVYFRNRGSIAVEDVNLMKG
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the nuoK gene in Nitrobacter hamburgensis?

The nuoK gene in Nitrobacter hamburgensis is part of the nuo operon encoding the NADH-quinone oxidoreductase complex, a critical component of the respiratory chain. This gene is found within the complete genome sequence of Nitrobacter hamburgensis X14, which has been fully sequenced and annotated . The gene is typically clustered with other nuo subunits (nuoA-N) in prokaryotic genomes, forming a functional transcriptional unit. In N. hamburgensis, the nuo operon is part of the core genome components that are conserved across Nitrobacter species, reflecting its essential role in energy metabolism.

What are the primary functions of nuoK within the NADH-quinone oxidoreductase complex?

The nuoK subunit functions as an integral membrane component of the NADH-quinone oxidoreductase (Complex I), participating in proton translocation across the cytoplasmic membrane during electron transfer. This process is fundamental to establishing the proton motive force necessary for ATP synthesis. Based on studies of similar oxidoreductase systems, the nuoK subunit likely contains multiple transmembrane helices that form part of the proton translocation machinery . Experimental evidence from analogous systems indicates that the nuoK subunit works in concert with other membrane-embedded subunits to couple electron transfer from NADH to quinones with proton pumping across the membrane, contributing to energy conservation during both heterotrophic and lithoautotrophic growth of Nitrobacter hamburgensis.

What expression systems are most effective for producing recombinant Nitrobacter hamburgensis nuoK?

For recombinant expression of membrane proteins like nuoK, Escherichia coli-based systems have demonstrated considerable success, particularly when using specialized strains optimized for membrane protein expression. Drawing from successful approaches with similar oxidoreductase subunits, a methodology utilizing E. coli BL21(DE3) with pET-based vectors under control of the T7 promoter often yields reliable results . For optimal expression, consider the following protocol parameters:

Expression ParameterRecommended SettingsRationale
Host strainE. coli C41(DE3) or C43(DE3)Specialized strains tolerant to membrane protein toxicity
Vector systempET28a with N-terminal His-tagEnables efficient purification under non-denaturing conditions
Growth temperature18-20°C after inductionReduces inclusion body formation
Inducer concentration0.1-0.5 mM IPTGLower concentrations favor proper membrane integration
Growth mediumTerrific Broth supplemented with 1% glucoseProvides metabolic support for membrane protein synthesis

This approach balances protein yield with proper membrane integration while facilitating subsequent purification steps.

How can codon optimization enhance expression of Nitrobacter hamburgensis nuoK in heterologous systems?

Codon optimization significantly improves expression of Nitrobacter hamburgensis proteins in heterologous hosts by addressing the GC-rich codon bias of Nitrobacter (approximately 62% GC content). Experimental approaches should focus on optimizing codons according to the expression host while preserving critical structural features. When expressing nuoK in E. coli, researchers should pay special attention to rare codons that may cause translational pausing and protein misfolding, particularly for membrane-embedded sequences. Analysis of synonymous codon usage patterns reveals that adjusting codons for arginine (AGG, AGA), leucine (CTA), and isoleucine (ATA) typically yields 2-3 fold improvement in expression levels. Additionally, eliminating mRNA secondary structures near the 5' translation initiation region further enhances expression efficiency by improving ribosome binding.

What are the critical considerations when designing fusion tags for nuoK purification that preserve native function?

The design of fusion tags for nuoK requires careful consideration of the protein's membrane topology to avoid disrupting structure-function relationships. Based on experimental evidence from similar oxidoreductase subunits, the following approach is recommended:

  • Position the affinity tag (preferably polyhistidine) at the N-terminus with a flexible linker (GGGGS) and TEV protease cleavage site to facilitate tag removal.

  • Avoid C-terminal tags as they may interfere with membrane integration or subunit interactions within the complex.

  • Consider using the twin-arginine translocation (TAT) signal sequence for proper membrane targeting when expressing in E. coli.

  • Implement mild detergent extraction protocols using non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations just above critical micelle concentration.

Functional validation should include assessment of protein-protein interactions with other complex subunits and electron transfer activity measurements using artificial electron acceptors like 2,6-dichloroindophenol .

What methods are most effective for studying interactions between nuoK and other subunits in the NADH-quinone oxidoreductase complex?

Multiple complementary approaches should be employed to comprehensively characterize nuoK interactions within the complex:

  • Co-immunoprecipitation with crosslinking: Using membrane-permeable crosslinkers (DSP or formaldehyde) to capture transient interactions before solubilization.

  • Bacterial two-hybrid system: Particularly the BACTH system optimized for membrane protein interactions.

  • Blue native PAGE: For analyzing intact complexes and subcomplexes after mild solubilization.

  • Surface plasmon resonance: For quantitative binding kinetics using purified components.

  • Heterodimer expression strategies: Similar to the approach used for NAD(P)H:quinone oxidoreductase studies where wild-type/mutant heterodimers were expressed to analyze subunit functional relationships .

The heterodimer approach is particularly valuable as it allows assessment of how mutations in one subunit affect the function of the entire complex. This methodology revealed that in analogous oxidoreductase systems, subunits can function independently with two-electron acceptors but exhibit interdependence with four-electron acceptors .

How do mutations in nuoK affect assembly of the complete NADH-quinone oxidoreductase complex?

Mutations in nuoK can significantly impact complex assembly depending on their location within the protein. Based on structure-function studies of similar subunits, mutations can be categorized as follows:

Mutation TypeEffect on AssemblyDetection Method
Transmembrane helix disruptionPrevents membrane integration and complex formationBlue native PAGE shows absence of complete complex
Conserved charged residues in proton channelsComplex forms but with altered stabilityThermal shift assays reveal decreased stability
Interface residues between adjacent subunitsIncomplete assembly or subcomplex formationSize exclusion chromatography shows altered elution profiles
Non-conserved surface residuesMinimal impact on assemblyComplex assembles normally with wild-type stoichiometry

Experimental approaches to assess these effects should include complementation studies in knockout strains and in vitro reconstitution experiments with purified components. Site-directed mutagenesis targeting conserved residues provides valuable insights into essential interactions governing complex assembly and stability.

What approaches can differentiate between structural and functional effects of nuoK modifications?

Distinguishing structural from functional effects requires a multi-faceted experimental approach:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure changes

    • Limited proteolysis to identify conformational alterations

    • Blue native PAGE to analyze complex assembly

  • Functional characterization:

    • NADH oxidation assays with different electron acceptors

    • Proton pumping measurements in reconstituted liposomes

    • Membrane potential measurements using potential-sensitive dyes

  • Comparative analysis:

    • Enzyme kinetics comparison between wild-type and modified variants

    • Determination of Km and kcat values with various substrates

    • Analysis of proton/electron transfer coupling ratios

What is the role of nuoK in electron transfer and proton pumping mechanisms?

The nuoK subunit plays a crucial role in the proton translocation machinery of the NADH-quinone oxidoreductase complex. As an integral membrane component, it forms part of the proton channel that couples electron transfer to proton pumping across the membrane. Mechanistic studies of similar respiratory complexes suggest that nuoK contains conserved charged residues that form part of a proton translocation pathway. These residues undergo conformational changes during the catalytic cycle, facilitating proton movement in response to redox changes in the electron transfer components of the complex.

The precise stoichiometry of proton pumping in N. hamburgensis NADH-quinone oxidoreductase appears to be adapted to the organism's lithoautotrophic lifestyle, potentially differing from heterotrophic bacteria. This adaptation may reflect the energetic constraints of growth on nitrite as an electron donor, where energy conservation efficiency is paramount for survival .

How can enzyme kinetics be measured for nuoK as part of the NADH-quinone oxidoreductase complex?

Enzyme kinetic measurements require isolation of intact complex or reconstitution of purified components:

  • Preparation of membrane particles or purified complex:

    • Isolate membrane fractions through differential centrifugation

    • Solubilize with mild detergents (DDM or digitonin)

    • Purify using affinity chromatography targeting tagged subunits

  • Activity assays:

    • NADH oxidation monitored spectrophotometrically at 340 nm

    • Reduction of artificial electron acceptors (menadione, 2,6-dichloroindophenol)

    • Quinone reduction monitored by absorbance changes

  • Kinetic parameter determination:

    • Vary substrate concentrations (NADH, quinones)

    • Calculate Km and Vmax using Michaelis-Menten or Lineweaver-Burk plots

    • Determine the effects of inhibitors on kinetics

For comparative analysis, enzyme kinetics should be measured with both artificial two-electron acceptors and physiological substrates, as subunit interactions may differ depending on the electron acceptor, similar to observations with NAD(P)H:quinone oxidoreductase .

How does environmental pH affect nuoK function within the oxidoreductase complex?

The pH dependence of nuoK function reflects its role in proton translocation and can be characterized through the following methodological approach:

pH RangeExpected EffectExperimental Observation Method
5.5-6.5Altered proton gradient affects efficiencyMeasure proton pumping efficiency in liposomes
7.0-7.5Optimal activity range for N. hamburgensisMaximum electron transfer rates observed
8.0-8.5Decreased proton availability may limit pumpingReduced coupling between electron transfer and proton pumping

Experiments should include:

  • pH-dependent activity assays measuring NADH oxidation rates

  • Proton pumping measurements in reconstituted proteoliposomes at various pH values

  • Analysis of pH-dependent conformational changes using intrinsic protein fluorescence

This pH profile information is particularly valuable when comparing N. hamburgensis nuoK with equivalent subunits from neutrophilic bacteria, as it may reveal adaptations specific to the ecological niche of nitrite-oxidizing bacteria.

How should researchers address unexpected kinetic data when studying nuoK mutants?

When confronted with kinetic data that contradicts initial hypotheses about nuoK function, researchers should implement a systematic troubleshooting approach:

  • Validate experimental procedures:

    • Confirm protein integrity through western blotting and mass spectrometry

    • Verify enzyme complex assembly using blue native PAGE

    • Assess detergent effects on enzyme activity

  • Consider alternative hypotheses:

    • Evaluate allosteric effects between subunits that may explain unexpected behavior

    • Analyze whether mutations affect proton pumping without changing electron transfer (or vice versa)

    • Investigate potential compensatory mechanisms in the complex

  • Implement advanced analyses:

    • Apply multiple substrate kinetic models to detect cooperative effects

    • Use temperature-dependent kinetics to separate thermodynamic parameters

    • Conduct pH profiles to identify ionizable groups affected by mutations

When facing contradictory data, maintain an open mind and consider that unexpected findings often lead to new discoveries about enzyme function . Document all experimental conditions meticulously to enable proper interpretation of anomalous results, particularly when comparing results across different experimental systems.

What statistical approaches are most appropriate for analyzing variable data in nuoK functional studies?

Given the inherent variability in membrane protein experiments, robust statistical analysis is crucial:

  • Appropriate statistical tests:

    • Use paired t-tests when comparing wild-type and mutant variants in the same preparation

    • Apply ANOVA with post-hoc tests when comparing multiple mutations

    • Consider non-parametric tests (Mann-Whitney U) when normality cannot be established

  • Sample size considerations:

    • Perform power analysis to determine minimum sample sizes

    • Conduct at least 3-5 independent protein preparations for each variant

    • Measure technical replicates (n≥3) for each preparation

  • Dealing with outliers:

    • Apply Grubb's test to identify statistical outliers

    • Document all exclusion criteria before data collection

    • Report all data, including outliers, with appropriate notation

For comprehensive interpretation, combine statistical significance testing with effect size measurements (Cohen's d) to evaluate the biological relevance of observed differences . This approach ensures that statistical significance aligns with functional significance in enzyme studies.

How can researchers differentiate between direct effects of nuoK mutations and indirect effects on complex assembly?

Distinguishing direct functional effects from assembly defects requires a systematic experimental approach:

  • Assembly verification:

    • Quantitative blue native PAGE analysis of complex formation

    • Subunit stoichiometry determination via quantitative mass spectrometry

    • Co-immunoprecipitation to assess subunit interactions

  • Functional complementation:

    • Co-expression of wild-type and mutant subunits to rescue function

    • Titration experiments with varying ratios of wild-type/mutant subunits

    • In vitro reconstitution with purified components

  • Structural verification:

    • Limited proteolysis to assess conformational states

    • Thermal stability assays to measure complex integrity

    • Chemical crosslinking to map interaction interfaces

Using this hierarchical approach, researchers can first establish whether the complex assembles correctly before attributing functional changes to specific mutations. This methodology is particularly effective for membrane protein complexes where assembly and function are intricately linked, similar to the approach used in heterodimer studies of oxidoreductases .

How does Nitrobacter hamburgensis nuoK differ from equivalent subunits in other nitrite-oxidizing bacteria?

Comparative genomic analysis reveals distinct features of N. hamburgensis nuoK relative to other nitrite-oxidizers:

  • Sequence conservation patterns:

    • Core functional residues are conserved across all nitrite-oxidizing bacteria

    • N. hamburgensis shows specific substitutions in transmembrane regions that may reflect adaptation to its ecological niche

    • Greater sequence similarity to alphaproteobacterial homologs than to distant nitrite oxidizers like Nitrospira

  • Genomic context differences:

    • In N. hamburgensis, the nuo operon organization is consistent with other alphaproteobacteria

    • Some nitrite oxidizers show different gene arrangements or split operons

    • Associated regulatory elements differ between Nitrobacter and other genera

  • Evolutionary signatures:

    • Analysis of the Nitrobacter "subcore" genome (genes unique to Nitrobacter after removing homologs from related species) indicates that respiratory chain components show evidence of adaptation to the nitrite-oxidizing lifestyle

    • Selective pressure analysis reveals higher conservation of residues involved in proton translocation compared to peripheral regions

These differences likely reflect adaptation to different ecological niches and energy conservation strategies among diverse nitrite-oxidizing bacteria.

What experimental approaches can establish the evolutionary significance of conserved residues in nuoK?

The evolutionary significance of conserved residues can be established through:

  • Phylogenetic analysis paired with functional testing:

    • Construct comprehensive phylogenetic trees of nuoK sequences

    • Identify type I (conserved across all lineages) and type II (conserved within specific clades) residues

    • Test the impact of mutations at these positions through site-directed mutagenesis

  • Ancestral sequence reconstruction:

    • Use maximum likelihood methods to infer ancestral nuoK sequences

    • Express and characterize reconstructed ancestral proteins

    • Compare functional properties with extant variants

  • Coevolution analysis:

    • Identify coevolving residues using statistical coupling analysis

    • Map these networks onto structural models

    • Test the functional importance of coevolving networks through simultaneous mutations

This integrated approach links sequence conservation patterns with functional significance, providing insights into the evolutionary forces shaping nuoK structure and function in Nitrobacter lineages compared to other bacterial groups.

How does the acquisition of foreign genes influence the function of the NADH-quinone oxidoreductase complex in Nitrobacter hamburgensis?

Genomic analysis of N. hamburgensis reveals evidence of horizontal gene transfer that may influence respiratory chain function:

  • Identification of horizontally acquired genes:

    • Genomic islands containing genes with divergent GC content

    • Presence of mobile genetic elements and restriction-modification systems

    • Genes with best BLAST matches to distantly related organisms

  • Functional implications:

    • Acquisition of additional electron transfer components that may interact with the NADH-quinone oxidoreductase complex

    • Presence of unique metabolic pathways that may provide alternative electron donors or acceptors

    • Integration of regulatory elements that control expression of respiratory chain components

  • Experimental verification:

    • Comparative expression analysis under different growth conditions

    • Protein-protein interaction studies between core and acquired components

    • Phenotypic analysis of deletion mutants for horizontally acquired genes

The N. hamburgensis genome contains several gene clusters that appear to have been acquired through horizontal gene transfer, potentially enhancing metabolic flexibility . These acquired genes may provide adaptive advantages by expanding the range of growth conditions under which the NADH-quinone oxidoreductase complex operates efficiently.

How can nuoK be utilized in synthetic biology applications for enhanced bioenergetics?

Nitrobacter hamburgensis nuoK can be leveraged in synthetic biology through:

  • Chimeric respiratory complexes:

    • Engineer hybrid complexes combining subunits from different species

    • Optimize proton pumping efficiency for enhanced ATP production

    • Create complexes with altered substrate specificity

  • Biosensor development:

    • Utilize nuoK as part of electron transfer chains in whole-cell biosensors

    • Develop sensors for nitrite detection in environmental samples

    • Create bioenergetic reporters for metabolic engineering

  • Bioenergetic enhancement:

    • Optimize nuoK expression for improved energy conservation

    • Engineer variants with enhanced coupling between electron transfer and proton pumping

    • Integrate optimized respiratory chains into chassis organisms for biotechnology

These applications require detailed understanding of structure-function relationships and the development of modular expression systems that facilitate incorporation of nuoK into diverse genetic contexts.

What experimental approaches can reveal the dynamics of nuoK conformational changes during catalysis?

Advanced biophysical techniques to study nuoK dynamics include:

  • Time-resolved spectroscopy:

    • Stopped-flow spectroscopy coupled with fluorescent probes

    • Electrochemical methods to trigger redox changes

    • Infrared spectroscopy to detect protonation state changes

  • Single-molecule approaches:

    • FRET pairs incorporated at strategic positions to monitor distance changes

    • High-speed atomic force microscopy for direct visualization

    • Nanodiscs coupled with single-particle analysis

  • Computational methods:

    • Molecular dynamics simulations of nuoK in membrane environments

    • QM/MM methods to model proton transfer events

    • Normal mode analysis to identify functionally relevant conformational changes

These approaches provide complementary insights into the dynamic processes occurring during catalysis, revealing how electron transfer events trigger conformational changes that facilitate proton translocation through the nuoK subunit.

How should researchers approach the challenge of resolving contradictory functional data for nuoK variants?

When faced with contradictory functional data, implement this systematic approach:

  • Validation of experimental systems:

    • Cross-validate results using multiple expression systems

    • Verify protein folding and membrane integration

    • Assess detergent effects on activity measurements

  • Comprehensive characterization:

    • Perform detailed kinetic analysis under various conditions

    • Measure multiple parameters (electron transfer, proton pumping)

    • Compare results with homologous systems from related organisms

  • Integration of structural information:

    • Map mutations onto structural models

    • Consider long-range allosteric effects

    • Analyze impact on interfaces with other subunits

  • Critical evaluation of hypotheses:

    • Develop alternative models to explain contradictory data

    • Design discriminating experiments to test competing hypotheses

    • Consider the possibility that both interpretations have validity under different conditions

By approaching contradictory data as an opportunity for deeper understanding rather than an experimental failure, researchers can often uncover complex regulatory mechanisms or context-dependent functions of nuoK that were not initially apparent .

What are the most effective detergents for solubilizing and purifying functional nuoK?

Detergent selection is critical for maintaining nuoK function during purification:

DetergentConcentrationAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)0.5-1% for extraction, 0.05% for purificationMild, preserves activity, widely usedLarge micelles may interfere with some analyses
Digitonin1-2% for extraction, 0.1% for purificationExcellent for preserving supercomplexesExpensive, variable purity
Lauryl maltose neopentyl glycol (LMNG)0.5-1% for extraction, 0.01% for purificationLow CMC, stable micellesRelatively new, fewer established protocols
Styrene maleic acid lipid particles (SMALPs)2.5% SMA copolymerPreserves native lipid environmentIncompatible with low pH, divalent cations

For optimal results, researchers should:

  • Screen multiple detergents using small-scale extractions

  • Assess protein quality by fluorescence-detection size exclusion chromatography

  • Validate function using activity assays with detergent-solubilized protein

  • Consider reconstitution into nanodiscs or liposomes for functional studies

The heterodimer purification approach used for NAD(P)H:quinone oxidoreductase can be adapted for nuoK studies, using nickel affinity chromatography with imidazole gradient elution to separate tagged wild-type/mutant heterodimers from homodimers .

How can researchers verify proper membrane insertion and topology of recombinant nuoK?

Verification of proper membrane insertion requires multiple complementary approaches:

  • Protease accessibility assays:

    • Limited proteolysis of membrane vesicles

    • Mass spectrometry identification of protected fragments

    • Comparison with predicted topology models

  • Reporter fusion approaches:

    • GFP fusions at termini or loops

    • PhoA/LacZ dual reporter system for topology mapping

    • Site-specific biotinylation using BirA ligase

  • Structural verification:

    • Electron microscopy of reconstituted complexes

    • Crosslinking with membrane-impermeable reagents

    • Spectroscopic analysis of labeled positions

  • Functional validation:

    • Complement activity in knockout strains

    • Reconstitution of purified protein into liposomes

    • Measure vectorial activities (proton pumping)

These methods collectively provide confidence in proper membrane insertion and orientation, which is essential for interpreting functional studies of nuoK variants.

What strategies can overcome the challenges of expressing hydrophobic membrane proteins like nuoK?

Expression of hydrophobic membrane proteins requires specialized strategies:

  • Optimization of expression constructs:

    • Use weak promoters to prevent overwhelming membrane insertion machinery

    • Include fusion partners that enhance solubility (MBP, SUMO)

    • Optimize ribosome binding sites for moderate translation rates

  • Host strain engineering:

    • Use C41/C43(DE3) strains designed for membrane protein expression

    • Consider strains with enhanced membrane production (BL21-AI)

    • Co-express chaperones that assist membrane protein folding

  • Culture condition optimization:

    • Reduce temperature after induction (16-20°C)

    • Use defined media with controlled osmolarity

    • Add chemical chaperones (glycerol, betaine) to stabilize folding intermediates

  • Alternative expression systems:

    • Cell-free expression systems with supplied membranes or nanodiscs

    • Yeast expression (P. pastoris) for eukaryotic-like membrane environment

    • Mammalian cell expression for complex membrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.