Recombinant Nitrobacter hamburgensis Probable intracellular septation protein A (Nham_0403)

Shipped with Ice Packs
In Stock

Description

Introduction to Nham_0403

Probable intracellular septation protein A (Nham_0403) is a gene product encoded by the Nitrobacter hamburgensis genome. This protein is implicated in bacterial cell division and intracellular organization. The recombinant form, expressed in E. coli with an N-terminal His tag, is widely used for structural and functional studies due to its high purity (>90%) and stability in lyophilized form .

Genomic Features

  • Gene locus: Nham_0403 is located on the chromosome of Nitrobacter hamburgensis X14, a soil-dwelling chemolithoautotroph known for nitrite oxidation .

  • Conservation: Part of a conserved "autotrophic island" on plasmid pPB13, shared with Nitrobacter winogradskyi and Nitrobacter sp. strain Nb-311A .

  • Paralogs and pseudogenes: The N. hamburgensis genome contains 634 paralogs (251 groups), but Nham_0403 itself has no direct paralogs, suggesting functional uniqueness .

Functional Role

While direct experimental evidence is limited, bioinformatic analyses suggest:

  • Septation involvement: Likely participates in cell division by mediating intracellular membrane septation, analogous to YciB-like proteins in other bacteria .

  • Metabolic linkage: Co-located with genes for central metabolism and energy conservation, hinting at roles in coordinating cell division with metabolic state .

Expression and Purification

ParameterSpecification
Host systemE. coli
TagN-terminal His tag
Amino acid sequence199 residues (MDKKQPHPLFKL...YHLEPATLEASDASEGDVRK)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer
Storage-20°C/-80°C; avoid freeze-thaw cycles

Reconstitution Protocol

  1. Centrifuge vial briefly before opening.

  2. Reconstitute in sterile water (0.1–1.0 mg/mL).

  3. Add glycerol (5–50% final concentration) for long-term storage .

Key Studies

  1. Genomic Analysis:

    • Nham_0403 is absent in the marine strain Nitrobacter sp. Nb-311A, suggesting niche-specific adaptations .

    • Co-conserved with nitrite oxidoreductase (NXR) genes, implying regulatory crosstalk between cell division and nitrite oxidation .

  2. Biotechnological Potential:

    • Antimicrobial targets: Septation proteins are promising targets for disrupting bacterial cell division .

    • Engineered nitrification: Could enhance metabolic efficiency in wastewater treatment systems .

Future Directions

  1. Functional assays: Clarify interactions with divisome machinery using pull-down assays .

  2. Structural studies: Cryo-EM or X-ray crystallography to resolve membrane-spanning architecture.

  3. Ecological impact: Assess gene expression under nitrite-limiting vs. rich conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yciB; Nham_0403; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
Nham_0403
Target Protein Sequence
MDKKQPHPLFKLATELGPLLVFFAANAKFNLFVATAAFMVAIVAAMIASYVVTRHIPLMA LVTGIVVIVFGTLTLVLHDETFIKVKPTIIYSLFAGVLGGGLLFGRSFIAIMFDQVFNLT PRGWQVLTLRWALFFFGMAILNELIWRTQSTDFWVNFKVFGAVPLTMIFAMMQMPLTKRY HLEPATLEASDASEGDVRK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of Nham_0403 in Nitrobacter hamburgensis?

Nham_0403 is located on the main chromosome (4.4 Mbp) of Nitrobacter hamburgensis X14, which represents one of four replicons in this organism's genome . The complete genome of N. hamburgensis includes three additional plasmids (294, 188, and 121 kbp), with the entire genome containing over 20% pseudogenes and paralogs . This genomic organization is significant as it contrasts with other Nitrobacter species where similar functionality may be encoded on different replicons. For example, approximately 21 kb of a 28-kb "autotrophic" island found on N. hamburgensis's largest plasmid appears in chromosomal locations in related species like Nitrobacter winogradskyi Nb-255 and Nitrobacter sp. strain Nb-311A . Understanding this genomic context helps researchers properly locate and characterize Nham_0403 within the organism's genetic architecture.

How does Nham_0403 compare functionally to known intracellular septation proteins in other bacteria?

Nham_0403 shares functional characteristics with the ispA gene characterized in Shigella flexneri, which codes for intracellular septation protein A . Based on comparative genomic analysis, we can infer that Nham_0403 likely plays a similar role in cell division processes. In S. flexneri, mutations in ispA lead to defects in intercellular spreading, with bacteria forming long filamentous structures lacking septa and becoming trapped within host cells . Additionally, such mutations affect actin polymerization capabilities, which are essential for intra- and inter-cellular spreading .

While specific experimental validation for Nham_0403 is still ongoing, its classification as a "probable" intracellular septation protein stems from sequence homology and predicted functional domains. Unlike the ispA in S. flexneri which is a small (21 kDa) hydrophobic protein , the complete characteristics of Nham_0403 require further experimental confirmation through protein expression and functional assays.

What expression systems are most suitable for producing recombinant Nham_0403?

For recombinant expression of Nham_0403, researchers should consider several systems based on the protein's predicted characteristics and the experimental goals. If Nham_0403 shares the hydrophobic properties observed in its homolog from S. flexneri , membrane protein expression systems may be most appropriate.

Table 1: Recommended Expression Systems for Nham_0403

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli BL21(DE3)High yield, economical, well-established protocolsMay not properly fold membrane proteinsCo-expression with chaperones may improve folding
Bacterial cell-free systemsAvoids toxicity issues, suitable for membrane proteinsLower yield than in vivo systemsRequires optimization of detergent conditions
Insect cell systemsBetter post-translational modifications, suitable for complex proteinsHigher cost, longer production timeRecommended for functional studies requiring proper folding
N. hamburgensis native expressionNatural folding and processingLow yield, technically challengingIdeal for validation of natural function

When designing expression constructs, consider including purification tags that will minimally interfere with the protein's structure and function. For hydrophobic membrane proteins, C-terminal tags are often preferable as they are less likely to interfere with membrane insertion mechanics during translation.

What are the key experimental design considerations when studying Nham_0403 function in vivo?

When designing experiments to study Nham_0403 function in vivo, researchers must adopt a rigorous experimental design approach that addresses causal relationships . This is particularly important when evaluating whether Nham_0403 is directly responsible for specific cellular phenotypes.

The experimental design should follow these principles:

  • Establish proper control conditions that allow you to isolate the effect of Nham_0403 from other variables

  • Address both propositions: "If Nham_0403 is present, then the outcome occurs" and "If Nham_0403 is absent, then the outcome does not occur"

  • Consider complementation experiments where the wild-type gene is reintroduced into mutant strains to restore function, similar to approaches used with ispA in S. flexneri

Knockout or knockdown experiments should be carefully designed, considering that essential septation proteins may result in lethal phenotypes. Conditional expression systems or partial knockdowns may be necessary. Additionally, researchers should evaluate potential polar effects on downstream genes when designing gene deletion constructs, which could confound interpretation of phenotypic results.

How can comparative genomic analyses enhance our understanding of Nham_0403?

Comparative genomic approaches provide powerful insights into Nham_0403 function and evolution. The creation of a "subcore" genome for Nitrobacter species, constructed by removing homologs found in closely related genera like Bradyrhizobium and Rhodopseudomonas, has already identified 116 genes unique to Nitrobacter . Researchers should determine if Nham_0403 belongs to this subcore, which would suggest its importance in Nitrobacter-specific functions.

Table 2: Comparative Genomic Analysis Framework for Nham_0403

Analysis LevelMethodological ApproachExpected OutcomesRelevant Species/Strains
Intra-genusAlignment with other Nitrobacter speciesConservation patterns, selective pressureN. hamburgensis, N. winogradskyi, Nitrobacter sp. strain Nb-311A
Family levelComparison with BradyrhizobiaceaeFunctional divergence, evolutionary historyBradyrhizobium japonicum, Rhodopseudomonas palustris
Functional homologsComparison with ispA-like genesFunctional constraints, convergent evolutionShigella flexneri, Escherichia coli
Structural homologs3D structure prediction and comparisonMechanistic insights, binding partnersVarious septation-related proteins

Many subcore genes in Nitrobacter have diverged significantly from the alphaproteobacterial lineage or have origins outside this lineage, potentially indicating genetic requirements for specific Nitrobacter functions like nitrite oxidation . Determining whether Nham_0403 follows this pattern could provide insights into its role in Nitrobacter's specialized metabolism.

What challenges exist in resolving the three-dimensional structure of Nham_0403?

Determining the three-dimensional structure of Nham_0403 presents several challenges, particularly if it shares the highly hydrophobic nature of its homolog in S. flexneri . Membrane proteins typically resist standard crystallization approaches used for soluble proteins.

For structural determination of Nham_0403, researchers should consider:

  • Detergent screening to identify optimal solubilization conditions

  • Construct optimization to remove disordered regions while maintaining functional domains

  • Alternative structural biology approaches including:

    • Cryo-electron microscopy for membrane proteins in lipid environments

    • NMR spectroscopy for dynamic regions

    • Cross-linking mass spectrometry to identify interaction surfaces

Computational approaches such as AlphaFold2 may provide preliminary structural models, but experimental validation remains essential, particularly for membrane proteins where prediction accuracy may be lower than for soluble proteins.

How might the function of Nham_0403 relate to the mixotrophic metabolism of N. hamburgensis?

N. hamburgensis X14 is classified as a facultative chemolithoautotroph that can oxidize nitrite to nitrate for energy conservation . The organism achieves its highest growth rates in media containing both nitrite and organic carbon , demonstrating metabolic flexibility. Investigating whether Nham_0403 contributes to this metabolic versatility represents an important research direction.

The relationship between septation proteins and metabolism might be explored through:

  • Growth experiments comparing wild-type and Nham_0403 mutant strains under various nutritional conditions

  • Microscopic analysis of cell morphology and division patterns under autotrophic versus heterotrophic growth

  • Transcriptomic analysis to identify co-regulated genes under different metabolic states

  • Proteomic approaches to identify interaction partners that might link septation to metabolic regulation

The N. hamburgensis chromosome contains many unique genes for metabolic functions, including those encoding heme-copper oxidases, cytochrome b(561), and pathways for catabolism of aromatic, organic, and one-carbon compounds . Investigation of potential regulatory or functional interactions between these metabolic systems and Nham_0403 could reveal novel insights into the coordination of cell division with metabolic state.

What are the most effective methods for site-directed mutagenesis of Nham_0403?

For site-directed mutagenesis of Nham_0403, researchers should employ techniques that account for the genomic context and potential challenges of working with N. hamburgensis. Since random Tn10 mutagenesis has been successfully used in similar research with bacterial septation proteins , targeted approaches can build upon this foundation.

Table 3: Site-Directed Mutagenesis Approaches for Nham_0403

Mutagenesis MethodTechnical ApproachAdvantagesConsiderations for N. hamburgensis
Primer-based PCR mutagenesisUse of mismatched primers to introduce specific mutationsPrecise, efficient for simple mutationsRequires optimization for GC-rich regions
Gibson AssemblySeamless assembly of DNA fragments with overlapping endsSuitable for complex modifications, insertionsEffective for introducing reporter fusions
CRISPR-Cas9Guide RNA-directed editing of genomic DNADirect genome editing without selection markersRequires optimization of transformation protocols
Allelic exchangeTwo-step process using counter-selectable markersMarkerless mutations, reduced polar effectsTime-consuming but reliable for difficult organisms

When designing mutations, focus on conserved residues identified through sequence alignment with functionally characterized homologs like ispA from S. flexneri. Consider creating a series of mutations that target:

  • Predicted functional domains

  • Protein-protein interaction surfaces

  • Membrane association regions

  • Potential regulatory sites

What cellular assays can effectively measure Nham_0403 activity and localization?

To assess Nham_0403 activity and localization, researchers should implement multiple complementary approaches:

  • Fluorescence Microscopy:

    • Create fluorescent protein fusions (preferably with monomeric variants like msfGFP)

    • Perform time-lapse imaging during cell division to track dynamic localization

    • Use super-resolution techniques (STED, PALM, STORM) for detailed localization patterns

  • Biochemical Assays:

    • Develop in vitro assays based on predicted enzymatic activities

    • Perform pull-down experiments to identify interaction partners

    • Use cross-linking approaches to capture transient interactions

  • Phenotypic Characterization:

    • Quantify cell morphology changes in mutant strains

    • Measure growth kinetics under various conditions

    • Assess cell division defects using membrane and DNA staining

  • Bacterial Two-Hybrid Systems:

    • Identify protein interaction partners

    • Map interaction domains through truncation analysis

    • Validate interactions through co-immunoprecipitation

When developing these assays, consider the challenges of working with N. hamburgensis, including its slower growth rate compared to model organisms and potential difficulties with genetic manipulation. Whenever possible, validate approaches in more tractable model systems expressing recombinant Nham_0403 before applying them to the native organism.

How can researchers overcome challenges in genetic manipulation of N. hamburgensis to study Nham_0403?

Genetic manipulation of non-model organisms like N. hamburgensis presents significant challenges. Researchers can overcome these obstacles through several strategies:

  • Transformation Protocol Optimization:

    • Test multiple electroporation parameters and buffer compositions

    • Consider alternative methods such as conjugation from E. coli donor strains

    • Develop protoplast transformation approaches if traditional methods fail

  • Selection Marker Considerations:

    • Determine appropriate antibiotic sensitivity profiles for N. hamburgensis

    • Consider non-antibiotic selection systems (auxotrophy complementation)

    • Use counter-selectable markers (sacB, rpsL) for clean genetic manipulations

  • Expression System Development:

    • Characterize native promoters from N. hamburgensis for controlled expression

    • Develop inducible systems that function in this organism

    • Create shuttle vectors compatible with both E. coli and N. hamburgensis

  • Heterologous Expression:

    • Express Nham_0403 in model organisms like E. coli for initial characterization

    • Consider expression in closely related alphaproteobacteria that may have similar cellular machinery

    • Use complementation studies in ispA mutants of model organisms to assess functional conservation

When working with the native organism, researchers should exploit the available genome sequence information to design targeted approaches, rather than relying solely on techniques optimized for model organisms.

How should researchers interpret contradictory findings when studying Nham_0403 function?

When faced with contradictory findings regarding Nham_0403 function, researchers should employ systematic approaches to resolve inconsistencies:

  • Experimental Conditions Analysis:

    • Document all experimental variables systematically

    • Test whether contradictions are condition-dependent (media composition, growth phase, temperature)

    • Implement factorial experimental designs to identify interaction effects

  • Statistical Rigor:

    • Apply appropriate statistical tests based on data distribution

    • Consider power analysis to ensure sufficient sample sizes

    • Implement blinded analysis where appropriate to reduce bias

  • Methodological Validation:

    • Cross-validate findings using independent techniques

    • Develop positive and negative controls specific to each assay

    • Consider interlaboratory testing for persistent contradictions

  • Biological Complexity Considerations:

    • Explore whether Nham_0403 has multiple functions depending on context

    • Investigate potential regulatory mechanisms that might explain variable results

    • Consider genetic background effects that might influence phenotypic outcomes

Resolution of contradictory findings often leads to deeper biological insights, potentially revealing complex regulation, moonlighting functions, or context-dependent activities of Nham_0403.

What bioinformatic approaches are most informative for analyzing the evolutionary history of Nham_0403?

To analyze the evolutionary history of Nham_0403, researchers should implement comprehensive bioinformatic approaches:

Table 4: Bioinformatic Analysis Strategies for Nham_0403

Analysis TypeMethodological ApproachExpected InsightsComputational Considerations
Sequence homologyBLAST, HMM profilesIdentification of homologs across speciesUse position-specific scoring matrices for distant homologs
Phylogenetic analysisMaximum likelihood, Bayesian methodsEvolutionary relationships and divergence timingSelect appropriate substitution models for membrane proteins
Synteny analysisComparative genomic contextConservation of genomic neighborhoodMay reveal functional associations and operonic structures
Selection pressure analysisdN/dS ratio calculationIdentification of conserved functional regionsRequires sufficient sequence diversity
Horizontal gene transfer detectionCompositional bias, phylogenetic incongruencePotential non-vertical inheritanceImportant given evidence of gene transfer in Nitrobacter

What statistical approaches are most appropriate for analyzing phenotypic data from Nham_0403 mutant studies?

When analyzing phenotypic data from Nham_0403 mutant studies, researchers should select statistical approaches that:

  • Match the experimental design:

    • For controlled experiments comparing mutant and wild-type strains, t-tests or ANOVA may be appropriate

    • For more complex designs with multiple factors, multi-way ANOVA or mixed models should be considered

    • For time-course experiments, repeated measures ANOVA or longitudinal data analysis methods are preferred

  • Address biological variability:

    • Implement appropriate transformations for non-normally distributed data

    • Consider non-parametric alternatives when assumptions of parametric tests are violated

    • Use robust statistical methods resistant to outliers

  • Account for multiple testing:

    • Apply correction methods (Bonferroni, Benjamini-Hochberg) when performing multiple comparisons

    • Consider global testing approaches before post-hoc comparisons

    • Implement false discovery rate control for high-dimensional data

  • Incorporate biological knowledge:

    • Use hierarchical or clustering approaches that reflect biological relationships

    • Implement Bayesian methods that can incorporate prior knowledge

    • Consider network-based analyses for interaction or pathway data

When reporting results, clearly state the statistical methods used, justification for their selection, and any assumptions made during analysis. This transparency enhances reproducibility and allows proper evaluation of the findings by the scientific community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.