Recombinant Nitrobacter hamburgensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag for your product.
Synonyms
lgt; Nham_3095; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
lgt
Target Protein Sequence
MFLLITYPVFDPVAISLGPIAIRWYALAYIGGIMLGWLYARALLKSEKLWGGPAPISGLQ LDDFILWVTIGIILGGRTGYVLFYNLDFFIRHPAEIFEIWKGGMSFHGGFMGCVVAVILF CRKHGLPILSLGDVATAVGPIGLFLGRIANFINSELWGRPADPSLPWAMVFPNGGPLPRH PSQLYEATLEGLVLFTILALMIRAGALKRPGLVLGSFITLYAMARIAGEFFREPDPQLGF LWGGLTMGMLLSAPMIIAGLAIICVAWSRGPRAPVAQTISTPDVSTKADRD
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrobacter hamburgensis and what makes its Lgt protein significant?

Nitrobacter hamburgensis X14 is a gram-negative facultative chemolithoautotroph belonging to the alphaproteobacteria class. This bacterium conserves energy by oxidizing nitrite to nitrate, playing a crucial role in nitrogen cycling in both natural ecosystems and wastewater treatment processes .

The prolipoprotein diacylglyceryl transferase (Lgt) in N. hamburgensis is significant because it catalyzes the first step in bacterial lipoprotein biogenesis. Specifically, Lgt attaches a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox sequence of preprolipoproteins via a thioether bond . This reaction is fundamental for proper lipoprotein processing and outer membrane integrity in gram-negative bacteria.

What is the genomic context of the lgt gene in Nitrobacter hamburgensis?

The complete genome of Nitrobacter hamburgensis X14 consists of four replicons: one chromosome (4.4 Mbp) and three plasmids (294, 188, and 121 kbp) . While the search results don't specifically identify the location of the lgt gene, genomic analysis has revealed that N. hamburgensis contains unique genes and gene clusters not found in other Nitrobacter species, with over 20% of its genome composed of pseudogenes and paralogs .

Comparative genomic analysis with other Nitrobacter species has identified a "subcore" genome of approximately 116 genes that are unique to the Nitrobacter genus, many of which have origins outside the alphaproteobacterial lineage . These genomic characteristics suggest that N. hamburgensis has undergone significant lateral gene transfer events throughout its evolutionary history, which may have influenced the current structure and function of genes like lgt.

How does Lgt function in the bacterial lipoprotein biogenesis pathway?

Lgt functions as part of a three-enzyme cascade responsible for lipoprotein biogenesis in gram-negative bacteria:

  • Lgt (Lipoprotein diacylglyceryl transferase): Catalyzes the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine in the lipobox sequence of preprolipoproteins .

  • LspA (Prolipoprotein signal peptidase): Cleaves the signal peptide N-terminal to the conserved diacylated cysteine .

  • Lnt (Lipoprotein N-acyl transferase): Adds a third acyl chain to the amino group of the N-terminal cysteine via an amide linkage .

After complete processing, mature triacylated lipoproteins destined for the outer membrane are transported via the Lol (lipoprotein outer membrane localization) system . This pathway is essential for proper membrane organization and bacterial viability.

What biochemical assays can be used to measure Nitrobacter hamburgensis Lgt activity?

While specific assays for N. hamburgensis Lgt activity aren't directly described in the search results, the methodology used for E. coli Lgt can be adapted. A robust biochemical assay involves measuring the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate .

Methodological approach:

  • Use a peptide substrate derived from a lipoprotein (e.g., Pal-IAAC, where C is the conserved cysteine modified by Lgt).

  • Detect glycerol phosphate release using coupled enzymatic reactions.

  • When using a phosphatidylglycerol substrate with a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released as Lgt catalyzes the reaction .

  • G3P detection can be accomplished via a coupled luciferase reaction for quantitative measurement .

For negative controls, use a mutant peptide substrate with the conserved cysteine mutated to alanine (e.g., Pal-IAA), which should not serve as a substrate for Lgt .

How can recombinant N. hamburgensis Lgt be expressed and purified for structural studies?

Based on principles used for other bacterial proteins, a protocol for expression and purification of recombinant N. hamburgensis Lgt could include:

  • Gene cloning:

    • Amplify the lgt gene from N. hamburgensis X14 genomic DNA

    • Clone into an expression vector with an appropriate affinity tag (His-tag is commonly used)

    • Transform into a suitable E. coli expression strain

  • Protein expression:

    • Induce expression in E. coli using IPTG or other appropriate inducer

    • Since Lgt is a membrane protein, consider using specialized E. coli strains designed for membrane protein expression

    • Culture at lower temperatures (16-20°C) may improve proper folding

  • Membrane extraction and solubilization:

    • Isolate bacterial membranes by differential centrifugation

    • Solubilize the membrane fraction using appropriate detergents (e.g., DDM, LDAO)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for further purification

    • Consider ion exchange chromatography as an additional purification step

  • Verification:

    • SDS-PAGE analysis

    • Western blotting

    • Activity assay measuring glycerol phosphate release as described earlier

How might inhibition of N. hamburgensis Lgt affect cell viability and membrane integrity?

Based on studies of Lgt in other bacteria, inhibition of N. hamburgensis Lgt would likely have profound effects on cell viability and membrane integrity. In E. coli, Lgt depletion leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics .

Inhibition of Lgt would prevent the first step in lipoprotein biogenesis, leading to:

  • Accumulation of unprocessed prolipoproteins

  • Compromised outer membrane integrity

  • Increased sensitivity to environmental stressors

  • Potential cell death due to critical membrane dysfunction

Unlike inhibition of later steps in lipoprotein biogenesis, deletion or inhibition of major outer membrane lipoproteins (e.g., lpp) is not sufficient to rescue growth after Lgt depletion, suggesting that Lgt inhibition affects multiple essential pathways simultaneously .

What strategies can be employed to develop specific inhibitors of N. hamburgensis Lgt?

Developing specific inhibitors for N. hamburgensis Lgt could follow these strategic approaches:

  • Structure-based drug design:

    • Determine the crystal structure of N. hamburgensis Lgt

    • Identify active site residues and substrate binding pockets

    • Use computational methods to screen for compounds that bind to these sites

  • High-throughput screening:

    • Develop a high-throughput biochemical assay based on glycerol phosphate release

    • Screen chemical libraries for compounds that inhibit Lgt activity

    • Follow up with secondary assays to confirm mechanism of action

  • Rationale design based on known inhibitors:

    • Adapt known Lgt inhibitors identified for other bacteria (e.g., G9066, G2823, and G2824 which inhibit E. coli Lgt with IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively)

    • Modify these compounds to increase specificity for N. hamburgensis Lgt

  • Substrate mimicry:

    • Design peptide-based inhibitors that mimic the lipobox sequence but contain modifications that prevent catalysis

    • Develop phosphatidylglycerol analogs that compete with the natural substrate

How does N. hamburgensis Lgt compare to Lgt enzymes in other bacterial species?

While the search results don't provide direct comparison of Lgt enzymes between species, we can make some inferences based on the genomic composition of Nitrobacter species. N. hamburgensis shares a "subcore" genome with other Nitrobacter species that contains genes that have diverged significantly from, or have origins outside, the alphaproteobacterial lineage .

A comparative analysis would likely reveal:

  • Conserved catalytic domains required for the diacylglyceryl transfer reaction

  • Species-specific variations in substrate specificity

  • Evolutionary adaptations related to ecological niche

  • Potential horizontal gene transfer events that may have influenced Lgt structure and function

A detailed bioinformatic analysis of Lgt sequence homology across bacterial species would provide valuable insights into its evolutionary conservation and functional importance.

What evidence exists for lateral gene transfer involving the lgt gene in Nitrobacter species?

The genomic analysis of Nitrobacter hamburgensis reveals significant evidence of lateral gene transfer (LGT) events throughout its evolutionary history. The genome contains several genomic islands and integrated elements not present in other Nitrobacter species . While specific LGT events involving the lgt gene aren't directly mentioned in the search results, several observations support the possibility:

  • Over 20% of the N. hamburgensis genome consists of pseudogenes and paralogs, indicating genomic plasticity .

  • N. hamburgensis has several large genomic islands (Nham_0784 to Nham_0835, Nham_0838 to Nham_0943, and Nham_1145 to Nham_1186) that appear to have integrated into its genome after divergence from a common ancestor with other Nitrobacter species .

  • Nitrobacter species have an above-average quantity of restriction-modification systems, which can function as "selfish" mobile genetic elements and promote homologous recombination .

  • Many genes in the Nitrobacter "subcore" genome have origins outside the alphaproteobacterial lineage, suggesting horizontal acquisition .

LGT events between prokaryotes are common mechanisms for acquiring new metabolic capabilities and adaptation to new ecological niches . The lgt gene, being essential for membrane integrity, could have undergone selection pressure following LGT events to optimize lipoprotein processing in the Nitrobacter cellular environment.

What approaches can be used to create recombinant expression systems for N. hamburgensis Lgt?

Creating recombinant expression systems for N. hamburgensis Lgt requires consideration of the protein's membrane-associated nature and potential toxicity. Based on standard molecular biology techniques, the following approaches can be employed:

  • Vector selection:

    • Inducible expression vectors (e.g., pET, pBAD) allow tight control of expression

    • Vectors with different copy numbers can help optimize expression levels

    • Consider fusion tags for purification (His, GST, MBP) and solubility enhancement

  • Host strain selection:

    • E. coli BL21(DE3) and derivatives for high-level expression

    • C41/C43 strains specifically developed for membrane protein expression

    • Consider Lemo21(DE3) for tunable expression of potentially toxic proteins

  • Expression conditions optimization:

    • Temperature (lower temperatures often improve membrane protein folding)

    • Inducer concentration (lower concentrations may reduce toxicity)

    • Growth media composition (rich vs. minimal media)

    • Addition of specific lipids or membrane stabilizers

  • Protein localization strategies:

    • Direct membrane integration using native signal sequences

    • Periplasmic expression with appropriate signal peptides

    • Cytoplasmic expression with subsequent refolding protocols

  • Functional verification:

    • Enzymatic activity assays measuring glycerol phosphate release

    • Complementation studies in Lgt-deficient bacterial strains

    • Structural characterization via crystallography or cryo-EM

What techniques are most effective for studying the substrate specificity of N. hamburgensis Lgt?

To study the substrate specificity of N. hamburgensis Lgt, several complementary techniques can be employed:

  • Synthetic peptide libraries:

    • Generate libraries of peptides with variations in the lipobox sequence [LVI][ASTVI][GAS]C

    • Measure activity using the glycerol phosphate release assay

    • Determine kinetic parameters (Km, Vmax) for different peptide substrates

  • Mass spectrometry:

    • Analyze the products of Lgt-catalyzed reactions using LC-MS/MS

    • Identify modifications on substrate peptides

    • Characterize the diacylglyceryl moieties transferred to the peptide

  • Phospholipid variation studies:

    • Test different phospholipid donors beyond phosphatidylglycerol

    • Analyze the efficiency of transfer with varying fatty acid compositions

    • Determine the stereoselectivity of the reaction

  • Site-directed mutagenesis:

    • Create variants of synthetic peptide substrates with systematic amino acid substitutions

    • Analyze the impact of these substitutions on catalytic efficiency

    • Generate a position-specific scoring matrix for optimal substrate sequences

  • Computational modeling:

    • Predict substrate binding using homology models of N. hamburgensis Lgt

    • Perform molecular dynamics simulations of enzyme-substrate interactions

    • Use machine learning approaches to predict substrate preferences

How can researchers develop a high-throughput screening assay for N. hamburgensis Lgt inhibitors?

Developing a high-throughput screening (HTS) assay for N. hamburgensis Lgt inhibitors would follow these methodological steps:

  • Primary assay development:

    • Adapt the glycerol phosphate detection assay to a 384- or 1536-well format

    • Optimize signal-to-background ratio and Z' factor for screening robustness

    • Implement a luminescence-based detection system using G3P oxidase coupled to luciferase

  • Assay validation:

    • Test known enzyme inhibitors as positive controls

    • Determine the DMSO tolerance of the assay

    • Assess assay reproducibility across plates and days

  • Compound screening:

    • Screen diverse chemical libraries for inhibitory activity

    • Perform dose-response studies for hit confirmation

    • Eliminate compounds with interference in the detection system

  • Secondary assays:

    • Counter-screen hits against related enzymes to determine specificity

    • Evaluate cytotoxicity against mammalian cells

    • Assess antibacterial activity against N. hamburgensis and other bacterial species

  • Mechanistic studies:

    • Determine if hits are competitive with peptide substrate or phospholipid donor

    • Evaluate binding kinetics using surface plasmon resonance

    • Identify binding sites through co-crystallization or molecular modeling

Table 1: Example HTS Assay Parameters for N. hamburgensis Lgt Inhibitor Screening

ParameterTarget ValueNotes
Assay format384-well plateMiniaturizable to 1536-well
Reaction volume20-50 μLMinimize reagent consumption
Enzyme concentration5-20 nMOptimized for signal window
Substrate concentration~KmFor identification of competitive inhibitors
Incubation time30-60 minutesBalance sensitivity and throughput
Z' factor>0.7Ensures statistical robustness
Signal-to-background>5Provides adequate dynamic range
Hit threshold>50% inhibitionInitial criterion for hit selection
DMSO toleranceUp to 2%Standard for compound libraries

How might gene editing techniques be applied to study Lgt function in N. hamburgensis?

CRISPR-Cas9 and other gene editing techniques could be applied to study Lgt function in N. hamburgensis through these methodological approaches:

  • Gene knockout studies:

    • Generate complete lgt gene knockouts if viable

    • Create conditional knockdowns using inducible systems

    • Analyze phenotypic changes in membrane integrity, growth, and stress response

  • Domain-specific mutations:

    • Introduce point mutations in catalytic residues

    • Create chimeric proteins with domains from other bacterial Lgt enzymes

    • Modify substrate binding sites to alter specificity

  • Promoter modifications:

    • Replace native promoters with inducible or constitutive promoters

    • Create reporter gene fusions to study expression patterns

    • Analyze co-regulation with other lipoprotein processing genes

  • Tag insertions:

    • Insert epitope tags for protein localization studies

    • Add fluorescent protein fusions for real-time visualization

    • Create affinity tags for in vivo interaction studies

  • Adaptation to different growth conditions:

    • Study the role of Lgt under various environmental stresses

    • Analyze contribution to nitrite oxidation and energy conservation

    • Examine interactions with other membrane proteins

These approaches would provide comprehensive insights into Lgt function in the context of N. hamburgensis physiology and metabolism.

What potential biotechnological applications exist for recombinant N. hamburgensis Lgt?

Recombinant N. hamburgensis Lgt has several potential biotechnological applications:

  • Vaccine development:

    • Creation of lipidated peptide vaccines with enhanced immunogenicity

    • Development of recombinant bacterial vectors with modified surface lipoproteins

    • Generation of adjuvants based on lipopeptide structures

  • Protein engineering:

    • Production of lipid-anchored proteins for biocatalysis

    • Creation of artificial membrane systems with functional lipoproteins

    • Development of biosensors using lipid-anchored recognition elements

  • Antibiotic development:

    • Use as a target for novel antibacterial compounds

    • Development of inhibitor screening platforms

    • Creation of bactericidal compounds specifically targeting nitrite-oxidizing bacteria

  • Bioremediation:

    • Engineering enhanced nitrite-oxidizing bacteria with modified membrane properties

    • Improving wastewater treatment processes through optimized nitrogen cycle bacteria

    • Development of immobilized enzyme systems for environmental applications

  • Synthetic biology:

    • Creation of artificial cell systems with engineered membrane architectures

    • Development of orthogonal lipoprotein processing systems

    • Design of bacteria with novel ecological functions

How might structural studies of N. hamburgensis Lgt contribute to understanding bacterial membrane biology?

Structural studies of N. hamburgensis Lgt would provide valuable insights into bacterial membrane biology through several avenues:

  • Membrane protein insertion mechanism:

    • Elucidate how Lgt recognizes and interacts with the membrane bilayer

    • Understand the orientation and topology of Lgt within the inner membrane

    • Identify structural features that facilitate substrate access from both aqueous and lipid environments

  • Substrate recognition:

    • Determine how Lgt specifically recognizes the lipobox sequence

    • Understand the binding pocket for phosphatidylglycerol

    • Identify conformational changes during catalysis

  • Evolutionary adaptations:

    • Compare with Lgt structures from other bacterial species

    • Identify species-specific adaptations related to ecological niche

    • Understand the structural basis for substrate specificity differences

  • Interaction with other membrane components:

    • Identify potential interaction sites with other lipoprotein processing enzymes

    • Understand how Lgt contributes to membrane organization

    • Elucidate the role of specific lipids in Lgt function

  • Drug design opportunities:

    • Identify druggable pockets specific to bacterial Lgt enzymes

    • Design inhibitors that disrupt essential structural features

    • Develop compounds that exploit unique aspects of N. hamburgensis Lgt structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.