Recombinant Nitrobacter hamburgensis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; Nham_0237; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
htpX
Target Protein Sequence
MSYFRTAILLAGLTGLFMGVGYLIGGAAGAMIALVVAAATNMFAYWNSDRMVLSMYGAHE VDAGTAPDLHRLVAELAARAALPMPRVFLMDNPQPNAFATGRNPENAAVAVTTGLMQSLR REELAGVIAHELAHIKHHDTLLMTITATIAGAISMLAQFGMFFGGGNRGNNGPGIIGSLA MMILAPLGAMLVQMAISRTREYAADEMGARICGQPMWLASALAKIDDAAHQVPNREAERA PATAHMFIINPLSGHGMDNLFATHPSTENRIAALQRLAGQSGSATPDPAPAPRGPWNGGA PRRGPWG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX homolog and what is its significance in bacteria?

Protease HtpX homolog is a membrane-bound zinc metalloprotease (EC 3.4.24.-) that plays a crucial role in proteolytic quality control systems within bacterial cells. It is particularly important for the maintenance of membrane protein integrity and degradation of misfolded proteins. In species like Escherichia coli, HtpX has been demonstrated to work in conjunction with FtsH (another membrane-bound ATP-dependent protease) to participate in the surveillance and degradation of membrane proteins that have become damaged or misfolded . The enzyme from Nitrobacter hamburgensis shares significant structural and functional similarities with other bacterial HtpX homologs, containing characteristic metalloprotease motifs and membrane-spanning domains. This protease represents an important component of bacterial stress response mechanisms, helping cells adapt to changing environmental conditions by maintaining the integrity of their protein composition, particularly within membrane structures .

What are the structural characteristics of N. hamburgensis Protease HtpX homolog?

The Nitrobacter hamburgensis Protease HtpX homolog is a membrane-associated protein consisting of 307 amino acid residues with a characteristic metalloprotease motif. Its amino acid sequence (MSYFRTAILLAGLTGLFMGVGYLIGGAAGAMIALVVAAATNMFAYWNSDRMVLSMYGAHE VDAGTAPDLHRLVAELAARAALPMPRVFLMDNPQPNAFATGRNPENAAVAVTTGLMQSLR REELAGVIAHELAHIKHHDTLLMTITATIAGAISmLAQFGMFFGGGNRGNNGPGIIGSLA MMILAPLGAmLVQMAISRTREYAADEMGARICGQPMWLASALAKIDDAAHQVPNREAERA PATAHMFIINPLSGHGMDNLFATHPSTENRIAALQRLAGQSGSATPDPAPAPRGPWNGGA PRRGPWG) reveals several transmembrane segments consistent with its membrane localization . Like other HtpX proteases, it contains the signature HEXXH zinc-binding motif that is essential for its proteolytic activity . The protein features multiple hydrophobic regions that anchor it within the membrane, positioning the catalytic domain appropriately for its function in protein quality control. The metalloprotease domain contains conserved histidine and glutamate residues that coordinate the zinc ion essential for catalytic activity. Structural predictions suggest that the N. hamburgensis HtpX homolog adopts a topology similar to the E. coli version, with multiple membrane-spanning regions and a cytoplasm-facing catalytic site .

How should the recombinant protein be stored and handled for optimal stability?

For optimal stability of Recombinant Nitrobacter hamburgensis Protease HtpX homolog, the protein should be stored at -20°C, and for extended storage periods, maintaining it at -20°C or -80°C is recommended . The protein is typically provided in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein's stability . Researchers should avoid repeated freezing and thawing cycles as this can significantly reduce enzymatic activity and lead to protein degradation. For short-term use, working aliquots can be stored at 4°C for up to one week . Similar to observations with E. coli HtpX, this protease is susceptible to self-degradation when improperly handled, particularly during membrane solubilization or cell disruption processes . Therefore, when designing experiments involving this recombinant protein, researchers should prepare fresh working aliquots when needed rather than repeatedly accessing frozen stocks. Additionally, considering the metalloprotease nature of HtpX, maintaining appropriate zinc ion concentrations in experimental buffers is crucial for preserving enzymatic activity .

What methods can be employed to measure the proteolytic activity of N. hamburgensis HtpX?

Several methodological approaches can be employed to measure the proteolytic activity of Nitrobacter hamburgensis HtpX. Based on studies with E. coli HtpX, one effective approach involves using model substrates such as α-casein in an in vitro proteolytic assay . In this methodology, the purified recombinant HtpX is incubated with the substrate under controlled conditions (appropriate buffer, temperature, and presence of zinc ions), followed by SDS-PAGE analysis to visualize the degradation products. The specific cleavage sites can be determined through N-terminal sequencing of the resulting fragments . Alternatively, researchers can employ fluorescent substrates with quenched fluorescence that emit measurable signals upon proteolytic cleavage, allowing for real-time monitoring of enzymatic activity.

For in vivo activity assessment, co-expression of HtpX with known substrates (such as SecY, based on E. coli studies) followed by western blot analysis can provide evidence of proteolytic activity within the cellular environment . Additionally, researchers can design experiments involving site-directed mutagenesis of the catalytic HEXXH motif (particularly the E137Q substitution in analogous positions) to create negative controls that demonstrate the specificity of observed proteolytic activity . The inclusion of metalloprotease inhibitors such as 1,10-phenanthroline or EDTA in parallel assays provides further confirmation of zinc-dependent activity . For quantitative analysis, kinetic parameters (Km, Vmax) can be determined using varying substrate concentrations and measuring the rate of product formation under controlled conditions.

How does N. hamburgensis HtpX compare functionally with HtpX homologs from other bacterial species?

The E. coli HtpX has been extensively characterized and demonstrated to function in conjunction with FtsH in quality control of membrane proteins, particularly targeting misfolded membrane proteins for degradation . It specifically cleaves the membrane protein SecY when overexpressed . While the N. hamburgensis homolog likely serves a similar quality control function, the specific substrates may differ due to the distinct metabolic requirements and environmental pressures faced by this nitrifying bacterium. Additionally, the membrane topology and substrate accessibility may vary between species due to differences in membrane composition and cellular architecture. The self-cleavage activity observed in E. coli HtpX is likely conserved in the N. hamburgensis homolog, though potentially with different regulatory mechanisms. Comprehensive functional characterization of the N. hamburgensis HtpX would require identification of its natural substrates and stress conditions that upregulate its expression, which may differ from those established for E. coli.

What experimental approaches can resolve challenges in purifying active HtpX for structural studies?

Purifying active HtpX presents significant challenges due to its membrane localization and tendency for self-degradation. Based on successful approaches with E. coli HtpX, researchers should consider a multifaceted strategy for N. hamburgensis HtpX purification . Initially, expression should be optimized in a suitable host system with the protein fused to an affinity tag to facilitate purification. Critical to success is the implementation of denaturing conditions during initial extraction and purification steps to prevent self-degradation, using agents such as urea or guanidinium hydrochloride .

The purification protocol should incorporate metal affinity chromatography under denaturing conditions, followed by a carefully controlled refolding process. This refolding should occur in the presence of a zinc chelator to temporarily inhibit proteolytic activity during the refolding process . After refolding, the protein should be transferred to a stabilizing buffer containing appropriate detergents for membrane protein stability, such as dodecylmaltoside (DDM) or digitonin. Controlled zinc ion reintroduction can then restore enzymatic activity when required for functional assays.

For structural studies, researchers might consider:

  • Cryo-electron microscopy, which can visualize membrane proteins in their native lipid environment

  • X-ray crystallography with stabilizing antibody fragments or nanobodies to restrict conformational flexibility

  • Site-directed mutagenesis of the catalytic residues to produce stable, inactive variants suitable for crystallization

  • Incorporation into nanodiscs or lipid cubic phases to maintain native-like membrane environments while facilitating structural analysis

These approaches minimize self-degradation issues while maintaining the structural integrity necessary for generating meaningful structural data .

How can researchers distinguish between the direct proteolytic activity of HtpX and its potential regulatory functions?

Distinguishing between the direct proteolytic activity and potential regulatory functions of HtpX requires sophisticated experimental design. Researchers should first establish a clear baseline of HtpX proteolytic activity using purified components in vitro, identifying cleavage sites and substrate preferences through mass spectrometry and N-terminal sequencing of degradation products . Site-directed mutagenesis of the catalytic HEXXH motif can create proteolytically inactive variants that retain structural integrity, which serves as an essential control to differentiate between direct proteolytic effects and potential non-proteolytic regulatory functions .

To investigate regulatory functions independent of proteolytic activity, researchers can employ comparative transcriptomics or proteomics between wild-type cells, HtpX knockout mutants, and cells expressing the catalytically inactive HtpX variant. This approach can reveal genes or proteins whose expression or stability depends on HtpX presence rather than its proteolytic activity. Protein-protein interaction studies using techniques such as bacterial two-hybrid systems, co-immunoprecipitation followed by mass spectrometry, or proximity labeling approaches can identify potential binding partners that might be regulated by HtpX through mechanisms other than proteolysis.

For in vivo studies, creating conditional expression systems allows temporal control over HtpX expression, enabling researchers to monitor immediate proteolytic events versus longer-term regulatory effects. Additionally, studying the interplay between HtpX and other quality control systems, such as the FtsH protease complex or chaperone networks, can provide insights into the broader regulatory role of HtpX in stress response pathways . The combined use of these approaches enables researchers to build a comprehensive model distinguishing the direct proteolytic functions from potential broader regulatory roles.

What controls should be included when studying N. hamburgensis HtpX proteolytic activity?

When designing experiments to study the proteolytic activity of Nitrobacter hamburgensis HtpX, several critical controls should be included to ensure reliable and interpretable results. First, a catalytically inactive mutant variant of the enzyme (typically created by site-directed mutagenesis of the HEXXH motif, particularly an E→Q substitution in the catalytic glutamate position) serves as an essential negative control . This mutant should maintain structural integrity but lack proteolytic activity, allowing researchers to distinguish specific HtpX-mediated proteolysis from background degradation.

Metal chelation controls using EDTA or 1,10-phenanthroline should be included to confirm the zinc-dependent nature of the observed proteolytic activity . These chelators should inhibit wild-type HtpX activity but have no additional effect on the already inactive mutant variant. Time-course analyses provide crucial information about the kinetics of substrate degradation and can reveal intermediate products that may be further processed.

Temperature controls (comparing activity at optimal versus non-permissive temperatures) and pH gradient experiments help establish the physiological relevance of the observed activity. When studying potential substrates, researchers should include structurally related proteins that are not expected to be HtpX substrates to demonstrate specificity. For in vivo experiments, complementation controls (reintroducing wild-type or mutant HtpX into knockout strains) confirm that observed phenotypes are specifically due to HtpX function. Finally, comparative analysis with well-characterized HtpX homologs (such as from E. coli) provides valuable reference points for interpreting results within the broader context of HtpX biology .

How can researchers optimize expression and purification of recombinant N. hamburgensis HtpX to maintain its native conformation?

Optimizing expression and purification of recombinant N. hamburgensis HtpX while maintaining its native conformation requires a carefully designed strategy addressing its membrane-associated nature and self-degradation tendencies. Expression system selection is critical, with E. coli C41(DE3) or C43(DE3) strains often preferred for membrane proteins due to their ability to accommodate high-level membrane protein expression with reduced toxicity . Alternatively, expression in native-like hosts might better preserve physiological folding environments.

Expression should be performed at reduced temperatures (16-20°C) with moderate inducer concentrations to slow protein production and facilitate proper membrane insertion and folding. Including appropriate membrane-mimetic environments during purification is essential, transitioning from harsh detergents during initial extraction to milder detergents or lipid nanodiscs for final preparation . Based on established protocols for E. coli HtpX, a two-phase purification approach is recommended:

  • Initial purification under denaturing conditions using 8M urea or 6M guanidinium hydrochloride to prevent self-degradation, utilizing affinity chromatography via an engineered tag

  • Controlled refolding through stepwise dialysis in the presence of a zinc chelator (to temporarily inhibit self-proteolysis), gradually introducing appropriate detergents while removing the denaturant

Once refolded, the protein should be maintained in buffers containing stabilizing agents such as glycerol (30-50%) and low concentrations of reducing agents to prevent oxidative damage . Zinc can be reintroduced once the protein is fully refolded and stabilized to restore enzymatic activity. Throughout purification, samples should be maintained at 4°C and processed rapidly to minimize degradation. Analytical techniques such as circular dichroism spectroscopy can verify proper refolding by comparing secondary structure profiles with predicted models or characterized homologs.

What approach should be used to identify native substrates of N. hamburgensis HtpX in vivo?

A complementary approach involves creating a catalytically inactive HtpX variant (through site-directed mutagenesis of the HEXXH motif) and expressing it in N. hamburgensis. This inactive "substrate trap" can form stable complexes with substrates that are normally rapidly degraded, facilitating their identification through co-immunoprecipitation followed by mass spectrometry . To enhance detection sensitivity, researchers can employ quantitative proteomics techniques such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling.

For directed studies, researchers can examine membrane proteins that become misfolded under stress conditions, focusing particularly on those with topology similar to SecY, a known substrate of E. coli HtpX . Validation of potential substrates should include in vitro degradation assays with purified components, mutational analysis of predicted cleavage sites, and in vivo co-expression studies with substrate candidates and either wild-type or inactive HtpX. Additionally, monitoring the accumulation of specific membrane protein fragments through targeted proteomics can provide evidence of HtpX-mediated cleavage events occurring within the cellular environment.

How does the membrane topology of HtpX influence its substrate selectivity and activity?

The membrane topology of HtpX proteases critically influences their substrate selectivity and catalytic activity. Based on studies of E. coli HtpX and structural predictions for the N. hamburgensis homolog, these proteins typically contain multiple transmembrane domains with the catalytic HEXXH motif positioned on the cytoplasmic face of the membrane . This specific arrangement restricts substrate accessibility to proteins or protein regions that are exposed to the cytoplasm or embedded within the membrane at accessible depths.

The positioning of the catalytic site relative to the membrane surface determines which segments of substrate proteins can reach the active site. For integral membrane substrates, HtpX likely recognizes specific topological features or exposed loops rather than sequence motifs alone. The transmembrane domains of HtpX may serve dual functions: anchoring the protease in the membrane and participating in substrate recognition through lateral interactions within the lipid bilayer . This membrane-embedded sensing mechanism allows HtpX to detect misfolded or damaged membrane proteins that exhibit altered conformations or exposure of normally buried residues.

The lipid composition of the membrane microenvironment likely modulates HtpX activity by affecting both enzyme and substrate conformations. Changes in membrane fluidity or composition during stress conditions may alter substrate accessibility or enzyme activity, potentially explaining the stress-responsive nature of HtpX function . Comparative analysis between HtpX homologs from different bacterial species reveals conserved transmembrane arrangements despite sequence variations, suggesting that the topology is fundamental to function. Researchers investigating substrate selectivity should consider not only primary sequence characteristics but also three-dimensional accessibility within the membrane context, as this spatial arrangement is likely a primary determinant of which proteins become HtpX substrates.

What is the relationship between HtpX and other proteolytic quality control systems in bacterial cells?

HtpX functions within an interconnected network of proteolytic quality control systems in bacterial cells, with significant evidence pointing to its collaborative role with other proteases and chaperones. In E. coli, HtpX has been established as working in conjunction with FtsH, an ATP-dependent membrane-bound protease, to eliminate misfolded membrane proteins . This relationship appears to be partially redundant yet complementary, with HtpX potentially processing substrates to facilitate their complete degradation by FtsH or targeting specific substrates that FtsH cannot efficiently process alone.

The interplay between HtpX and other quality control systems likely extends beyond FtsH. Periplasmic proteases and chaperones, including those involved in envelope stress responses (such as the σE pathway), may coordinate with HtpX to maintain membrane integrity under stress conditions. Additionally, based on search result information about BepA (YfgC), which promotes both assembly and elimination of outer membrane proteins depending on their folding state, HtpX might participate in similar decision-making processes for inner membrane proteins .

Regulatory relationships also exist at the transcriptional level. In many bacteria, htpX expression is upregulated under conditions that induce protein misfolding, particularly heat shock, suggesting coordination with heat shock response regulators. This creates a multi-layered quality control network where chaperones attempt to refold membrane proteins, while proteases like HtpX and FtsH eliminate those beyond repair.

For N. hamburgensis specifically, understanding these relationships requires investigating the co-expression patterns of htpX with other quality control genes under various stress conditions, performing epistasis analyses with multiple protease knockout combinations, and mapping the substrate overlap between HtpX and other proteolytic systems. This would reveal whether the collaborative quality control network observed in E. coli is conserved in N. hamburgensis and how it might be adapted to the specific physiological requirements of this nitrifying bacterium.

What techniques are most effective for studying the interaction between HtpX and membrane-bound substrates?

Investigating interactions between HtpX and its membrane-bound substrates presents unique challenges requiring specialized techniques that preserve the native membrane environment. Based on successful approaches with similar membrane proteases, several methodologies are particularly effective for studying these interactions.

Reconstituted membrane systems offer controlled environments for interaction studies. Proteoliposomes containing purified HtpX and potential substrate proteins allow for direct observation of proteolytic activity while maintaining a membrane context . Nanodiscs represent an advanced alternative, providing a defined lipid bilayer disc that better mimics native membrane curvature while being amenable to various biophysical techniques. For in vivo approaches, site-specific crosslinking using unnatural amino acids incorporated at predicted interaction sites can capture transient enzyme-substrate complexes for subsequent identification.

FRET (Förster Resonance Energy Transfer) pairs strategically placed on HtpX and substrate proteins can monitor real-time interactions in living cells or reconstituted systems, providing spatial and temporal information about the interaction dynamics. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is particularly valuable for identifying which regions of substrate proteins become protected upon HtpX binding, revealing interaction interfaces without requiring protein crystallization.

For structural studies at higher resolution, cryo-electron microscopy of HtpX-substrate complexes in membrane environments offers the potential to visualize interaction details while maintaining native-like conditions. This can be complemented by computational approaches such as molecular dynamics simulations of HtpX and substrates within lipid bilayers to predict interaction mechanisms and substrate recognition determinants. Atomic force microscopy can provide topographical information about HtpX organization within membranes and potential conformational changes upon substrate binding. Together, these techniques provide complementary data to build comprehensive models of how HtpX recognizes, binds, and processes its membrane-bound substrates.

How can researchers address the challenge of HtpX self-degradation during experimental work?

The self-degradation property of HtpX proteases presents a significant challenge for experimental work, requiring strategic approaches to obtain meaningful results. Based on documented experiences with E. coli HtpX, researchers can implement several tactics to address this issue when working with the N. hamburgensis homolog . The most effective approach involves temporary inactivation of the enzyme during extraction and purification processes, followed by controlled reactivation under experimental conditions.

Specific methodological strategies include:

  • Purification under denaturing conditions using 6-8M urea or guanidinium hydrochloride, which unfolds the protein and prevents catalytic activity

  • Inclusion of zinc-chelating agents (EDTA or 1,10-phenanthroline) during initial extraction and purification steps to remove the catalytic zinc ion essential for activity

  • Engineering a catalytically inactive mutant (typically E→Q substitution in the HEXXH motif) for structural studies or as a stable negative control

  • Employing rapid purification protocols at reduced temperatures (4°C) to minimize the time during which self-degradation can occur

  • Stabilization with appropriate protease inhibitor cocktails that target metalloproteases when working with cell lysates

For reactivation, researchers can use controlled dialysis to gradually remove denaturants while introducing stabilizing agents such as glycerol, followed by careful zinc reintroduction to restore catalytic activity only when needed for specific assays . Additionally, working with freshly prepared protein whenever possible and avoiding storage of active enzyme preparations for extended periods helps maintain experimental reproducibility. When designing in vivo experiments, utilizing inducible expression systems with tight regulation prevents premature accumulation and self-degradation of HtpX, allowing for precisely timed experimental interventions.

What emerging technologies might enhance our understanding of HtpX function in bacterial membrane homeostasis?

Emerging technologies promise to significantly advance our understanding of HtpX function in bacterial membrane homeostasis. Single-cell proteomics techniques are evolving rapidly, potentially allowing researchers to monitor HtpX-mediated proteolysis at the individual cell level, revealing cell-to-cell variability in protease activity and substrate processing that might be masked in population-based studies. This approach could illuminate how subpopulations of bacteria utilize HtpX differently during stress responses.

Cryo-electron tomography represents another frontier technology, enabling visualization of HtpX in its native membrane environment within intact cells, potentially capturing its distribution, organization, and association with other quality control machinery. This would provide unprecedented structural context for understanding HtpX function. For studying dynamic processes, developments in time-resolved mass spectrometry can track the progression of HtpX-mediated substrate degradation, identifying intermediate cleavage products and establishing the chronology of proteolytic events.

Advanced protein engineering approaches, such as directed evolution coupled with high-throughput screening, could generate HtpX variants with enhanced stability or altered substrate specificity, providing valuable tools for dissecting function. Optogenetic control systems adapted for bacterial proteins offer the exciting possibility of light-activated HtpX variants, allowing precise temporal control over protease activity for studying immediate consequences of HtpX activation.

In the computational domain, improved membrane protein structure prediction algorithms, particularly those incorporating co-evolutionary information, can generate increasingly accurate models of HtpX-substrate interactions. These can guide experimental design and interpretation. Finally, microfluidic devices coupled with real-time imaging enable monitoring of single bacterial cells under precisely controlled stress conditions, potentially revealing the dynamics of HtpX-mediated responses with unprecedented temporal resolution. Integration of these technologies would provide a multi-dimensional view of HtpX function in maintaining membrane protein homeostasis under various physiological and stress conditions.

How might HtpX function differ in extremophilic bacteria compared to mesophilic species like N. hamburgensis?

HtpX function likely exhibits significant adaptations in extremophilic bacteria compared to mesophilic species like Nitrobacter hamburgensis, reflecting the unique challenges of maintaining membrane protein homeostasis under extreme conditions. In thermophilic bacteria, HtpX homologs would require enhanced thermostability, potentially achieved through increased hydrophobic interactions, additional salt bridges, and higher proline content in loop regions. These structural adaptations would need to preserve catalytic flexibility while preventing denaturation at elevated temperatures. The substrate recognition mechanism might also differ, with thermophilic HtpX potentially recognizing more subtle deviations from native protein conformations, as the threshold between normal thermal fluctuations and damaging misfolding becomes narrower at high temperatures.

In psychrophilic (cold-adapted) bacteria, the opposite adaptations would be expected - HtpX would likely exhibit increased flexibility, particularly around the active site, with reduced structural stability to maintain catalytic activity at low temperatures. Substrate recognition might be more stringent, as cold-induced protein misfolding typically manifests differently than heat-induced damage. The membrane environment itself differs dramatically between mesophiles and extremophiles, with altered lipid composition significantly affecting membrane fluidity and consequently HtpX's ability to access substrates within the membrane.

Halophilic bacteria present another interesting comparison, as their HtpX homologs would operate in high-salt cytoplasmic environments, requiring negative surface charge distribution and specialized ion interactions to maintain solubility and activity. Their substrates would also exhibit halophilic adaptations, potentially altering recognition determinants. For acidophiles and alkaliphiles, HtpX would need to maintain optimal activity despite extreme pH environments that could affect both the ionization state of catalytic residues and substrate conformation.

Comparative genomic and structural analyses of HtpX across these diverse bacterial groups could reveal how this essential quality control protease has evolved specialized mechanisms to function effectively across extreme environmental conditions, potentially informing the engineering of HtpX variants with novel properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.