Recombinant Nitrobacter hamburgensis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Overview

Enzyme Classification

  • EC Number: 3.6.1.27

  • Systematic Name: Undecaprenyl-diphosphate phosphohydrolase

  • Alternative Names: BacA, C55-isoprenyl diphosphatase, Undecaprenyl pyrophosphate phosphatase (UppP) .

Catalytic Reaction

Undecaprenyl diphosphate+H2OUndecaprenyl phosphate+Phosphate\text{Undecaprenyl diphosphate} + \text{H}_2\text{O} \rightarrow \text{Undecaprenyl phosphate} + \text{Phosphate}

This reaction is essential for recycling undecaprenyl phosphate, a carrier lipid used in peptidoglycan biosynthesis .

Cell Wall Synthesis

  • Peptidoglycan Biosynthesis: UppP recycles undecaprenyl phosphate, enabling continuous lipid carrier availability for glycan chain assembly .

  • Bacitracin Resistance: UppP counteracts bacitracin’s inhibition of lipid carrier recycling, conferring antibiotic resistance .

Genomic Context

  • Gene Location: Chromosomal gene in N. hamburgensis (Nham_0184), distinct from plasmid-encoded metabolic genes .

  • Subcore Genes: Part of the Nitrobacter-specific subcore genome, indicating evolutionary conservation .

Comparative Insights

  • Bifunctional Homologs: Unlike Streptococcus mutans undecaprenol kinase (UK), which exhibits dual kinase/phosphatase activity, N. hamburgensis uppP is monofunctional .

  • Structural Studies: E. coli uppP crystal structures (PDB: 5OON, 6CB2) reveal a membrane-bound architecture distinct from soluble phosphatases .

Research Applications

  • Antibiotic Resistance Studies: Used to investigate bacitracin’s mechanism and potential resistance strategies .

  • Enzyme Engineering: Serves as a model for modifying phosphatase activity in synthetic biology .

  • Structural Biology: Recombinant uppP facilitates studies on membrane protein folding and active-site dynamics .

Key Challenges and Future Directions

  • Partial Sequence Limitations: Current recombinant versions are truncated, necessitating full-length expression for comprehensive studies .

  • Cation Dependence: Optimal activity requires Ca²⁺ or Mg²⁺, complicating in vitro assays .

  • Industrial Potential: Scalable production methods are needed for biotechnological applications in antibiotic development or lipid metabolism research.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag if possible.
Synonyms
uppP; Nham_0184; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Target Names
uppP
Target Protein Sequence
MFSDAIRAVILGIVEGVTEFLPVSSTGHLLLAERFFDLGSGNFWNTFTVLIQLGAILAIV VIYFEKLWRIALGMFSNDADRRFVIGVLAAFLPAVVVGLIAGKYIKELLFNPWVVCFSLI VGGAVLMWVDQLDHKPHEHDATAFPLPMYIWIGIAQCLAMIPGVSRSGATIVSAMLLGAD KRAAAEFSFFLAIPTMIGAFAYDFYKNRADMTTDHLGIVAIGFVVSFVTAIVVVKAFLSY VTRNGFTFFAWWRVIVGTLGLIALALGR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function in bacteria?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is a membrane-bound enzyme that plays a critical role in bacterial cell wall synthesis. Its primary function is to dephosphorylate undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as a lipid carrier for peptidoglycan precursors during cell wall biosynthesis . This dephosphorylation step is essential for recycling the lipid carrier and maintaining cell wall integrity. In Nitrobacter species, as in other bacteria, this enzyme contributes significantly to cell wall metabolism and is implicated in resistance to certain antibiotics, particularly bacitracin, which targets this specific pathway .

How does the structure of UppP relate to its function?

The UppP protein is predicted to be a highly hydrophobic integral membrane protein with approximately eight transmembrane helices . This transmembrane structure is critical for its function as it positions the enzyme within the cell membrane where it can access its substrate, undecaprenyl pyrophosphate. The hydrophobic nature of UppP allows it to be properly embedded in the lipid bilayer where cell wall precursor synthesis occurs. The catalytic site is oriented to face the periplasmic space, allowing for the dephosphorylation reaction to occur at the interface between the cell membrane and the area where cell wall assembly takes place . This structural arrangement is conserved across various bacterial species, indicating its fundamental importance to bacterial physiology.

What is the relationship between UppP and bacitracin resistance?

UppP plays a significant role in conferring resistance to bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate and prevents its dephosphorylation, thereby inhibiting cell wall synthesis. Research on Enterococcus faecalis has demonstrated that UppP mediates low-level bacitracin resistance . When the uppP gene is inactivated, bacteria show increased susceptibility to bacitracin, with MICs decreasing from 32-48 mg/L in wild-type strains to 3-6 mg/L in uppP mutants . Conversely, overexpression of uppP increases bacitracin resistance, with MICs rising to 128-≥256 mg/L . The BacA-type UppP found in many bacteria, including Nitrobacter species, serves as a primary defense mechanism against bacitracin by ensuring the continued cycling of the undecaprenyl carrier through efficient dephosphorylation of undecaprenyl pyrophosphate.

How does Nitrobacter hamburgensis UppP compare to UppP from other bacterial species?

While specific data on Nitrobacter hamburgensis UppP is limited in the provided sources, comparisons can be drawn based on information about related bacterial enzymes. UppP proteins generally show high sequence conservation across different bacterial species, suggesting similar structural and functional properties . For instance, the UppP from Enterococcus faecalis displays high sequence identity to the Escherichia coli BacA-type UppP . Nitrobacter hamburgensis, as a soil bacterium with distinct metabolic capabilities compared to E. faecalis or E. coli, may have evolved variations in its UppP to adapt to its ecological niche. Nitrobacter species are known for their mixotrophic and heterotrophic capabilities, with N. hamburgensis specifically having heterotrophic tendencies . These metabolic characteristics might influence the regulation and function of its UppP enzyme, potentially optimizing it for the specific environmental conditions encountered by this bacterium.

What factors influence UppP expression and activity in Nitrobacter species?

The expression and activity of UppP in Nitrobacter species are likely influenced by multiple environmental and metabolic factors. Based on studies of Nitrobacter communities, several key factors emerge:

Unlike some enzymes, UppP expression in at least some bacteria appears to be constitutive rather than inducible, as studies in E. faecalis showed that uppP-lacZ expression was not affected by bacitracin or cell wall-active antimicrobials .

How do different environmental stressors affect UppP function and bacterial survival?

Environmental stressors can significantly impact UppP function and, consequently, bacterial survival. While direct data on N. hamburgensis UppP is limited, insights can be drawn from related research:

What experimental approaches are most effective for studying UppP activity in relation to bacterial metabolism?

Several experimental approaches can be particularly effective for studying UppP activity in relation to bacterial metabolism:

How does the specific activity of UppP compare across different growth phases in Nitrobacter species?

The specific activity of enzymes in Nitrobacter species shows significant variation across growth phases, which likely applies to UppP as well. Based on studies of nitrite oxidation in Nitrobacter communities, we can infer patterns that might be relevant to UppP activity:

Growth PhaseRelative Specific ActivityKey Characteristics
Early Growth Phase (Days 2-7)20-40× higher than later phasesRapid growth, high metabolic activity, primarily autotrophic metabolism
Late/Stationary Phase (Days 15-48)Significantly reducedStabilization of community, shift toward heterotrophic metabolism, possible oxygen limitation

Data from nitrite oxidation studies shows that specific activity in the early phase was 0.45-0.46 units, dropping dramatically to 0.01-0.02 units in the later phase . This represents a 20-fold to 40-fold decrease in specific activity as the bacterial community matures.

N. hamburgensis, with its heterotrophic tendencies, might maintain higher UppP activity during stationary phase compared to more autotrophic Nitrobacter strains, as heterotrophic metabolism appears to be more tolerant to environmental changes and allows for continued growth even under limiting conditions .

What are the optimal conditions for expressing and purifying recombinant Nitrobacter hamburgensis UppP?

Based on protocols for similar recombinant proteins, the following considerations are important for optimal expression and purification of Nitrobacter hamburgensis UppP:

  • Expression System: E. coli is typically used as the expression host for recombinant bacterial proteins, including UppP from various species . For membrane proteins like UppP, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results.

  • Expression Vectors: Vectors with adjustable induction systems (like pET series) allow for controlled expression, which is crucial for membrane proteins that can be toxic when overexpressed. Addition of appropriate tags (His-tag, FLAG-tag, etc.) facilitates purification while maintaining enzymatic activity.

  • Induction Conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the folding of membrane proteins like UppP. Extended expression times (overnight or longer) at these lower temperatures can increase yields of properly folded protein.

  • Membrane Extraction: Effective extraction of UppP from membranes requires careful selection of detergents. Mild detergents like n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or digitonin are often suitable for maintaining the structure and function of membrane proteins.

  • Purification Strategy: For His-tagged UppP, immobilized metal affinity chromatography (IMAC) using Ni-NTA resins is typically effective. This should be followed by size exclusion chromatography to improve purity and remove aggregates. Throughout purification, maintaining a consistent detergent concentration above the critical micelle concentration is essential.

  • Buffer Optimization: Phosphate buffers at physiological pH (around 7.4) with added glycerol (10-20%) and appropriate salt concentrations (typically 150-300 mM NaCl) help stabilize the protein during purification. For UppP specifically, inclusion of divalent cations (Mg²⁺ or Mn²⁺) may be important for maintaining enzymatic activity.

  • Quality Control: Assessing the purity by SDS-PAGE (aiming for >85% purity) and verifying activity through enzymatic assays are essential steps to ensure the quality of the purified recombinant UppP.

How should recombinant UppP be stored to maintain optimal activity?

Proper storage of recombinant UppP is critical for maintaining its enzymatic activity. Based on available information about similar proteins, the following recommendations can be made:

What are the recommended reconstitution procedures for lyophilized recombinant UppP?

Reconstitution of lyophilized recombinant UppP requires careful attention to several factors to ensure maximum recovery of enzymatic activity:

  • Initial Handling: Before opening the vial containing lyophilized UppP, it should be briefly centrifuged to bring the contents to the bottom, preventing loss of material when the vial is opened .

  • Reconstitution Solution: Deionized sterile water is recommended as the primary reconstitution medium . The protein should be reconstituted to a concentration between 0.1-1.0 mg/mL for optimal stability and activity .

  • Glycerol Addition: After initial reconstitution in water, addition of glycerol to a final concentration of 5-50% is recommended for samples intended for storage . A 50% final glycerol concentration has been suggested as a standard approach .

  • Temperature Considerations: Reconstitution should typically be performed at room temperature or 4°C, depending on the stability of the specific protein. Gentle mixing rather than vigorous shaking helps prevent protein denaturation.

  • Detergent Inclusion: For membrane proteins like UppP, inclusion of an appropriate detergent in the reconstitution buffer at a concentration above its critical micelle concentration (CMC) is essential to prevent aggregation and maintain a native-like environment.

  • Equilibration Time: After adding the reconstitution solution, the sample should be allowed to stand for a short period (typically 5-10 minutes) before mixing to ensure complete wetting of the lyophilized powder.

  • Verification of Solubilization: After reconstitution, the solution should be visually inspected to ensure complete dissolution of the protein. If particulate matter is observed, gentle mixing or brief centrifugation may be necessary.

  • Activity Testing: Following reconstitution, it is advisable to test a small aliquot for enzymatic activity to confirm successful recovery of functional protein before proceeding with experiments.

What analytical methods are most appropriate for assessing UppP enzyme kinetics?

Several analytical methods can be employed to assess UppP enzyme kinetics effectively:

  • Colorimetric Phosphate Detection: Since UppP functions as a phosphatase, releasing inorganic phosphate (Pi) from undecaprenyl pyrophosphate, colorimetric assays such as the malachite green or molybdate-based assays can be used to quantify phosphate release as a measure of enzyme activity.

  • Radiometric Assays: Using radiolabeled substrates (³²P-labeled undecaprenyl pyrophosphate) allows for highly sensitive detection of phosphatase activity. The released [³²P]phosphate can be separated from the substrate by extraction or chromatography and quantified by scintillation counting.

  • HPLC Analysis: High-performance liquid chromatography can separate and quantify the substrate (undecaprenyl pyrophosphate) and product (undecaprenyl phosphate), allowing for direct measurement of reaction progress.

  • Mass Spectrometry: LC-MS/MS approaches can provide detailed kinetic information by precisely measuring the conversion of substrate to product over time, even in complex mixtures.

  • Fluorescence-Based Assays: Coupling UppP activity to fluorogenic substrates or secondary enzyme reactions that produce fluorescent products can allow for continuous, real-time monitoring of enzyme activity.

  • Enzyme-Coupled Assays: Linking UppP activity to other enzymatic reactions that produce easily detectable products can amplify the signal and improve assay sensitivity.

  • Surface Plasmon Resonance (SPR): For studying binding kinetics of inhibitors or substrates to UppP, SPR can provide detailed information about association and dissociation rates.

For determining key kinetic parameters:

  • K<sub>m</sub> and V<sub>max</sub>: These can be determined by measuring initial reaction velocities at varying substrate concentrations and fitting the data to the Michaelis-Menten equation.

  • k<sub>cat</sub>: The turnover number can be calculated from V<sub>max</sub> when the enzyme concentration is precisely known.

  • Inhibition Constants: For studying bacitracin resistance mechanisms, determining K<sub>i</sub> values for various inhibitors can provide insights into the molecular basis of resistance.

What are the future research directions for understanding the role of UppP in Nitrobacter species?

Future research on UppP in Nitrobacter species could productively focus on several key areas:

  • Comparative Genomics and Evolution: Detailed comparison of uppP genes across different Nitrobacter species and strains could reveal evolutionary adaptations related to their specific ecological niches. This could include analyzing sequence conservation, gene synteny, and potential horizontal gene transfer events that might have influenced UppP function in these bacteria.

  • Regulatory Networks: Investigating the transcriptional and post-translational regulation of UppP in Nitrobacter hamburgensis could provide insights into how this enzyme is integrated into the bacterium's broader metabolic networks. This could include identifying transcription factors that control uppP expression and characterizing any potential post-translational modifications that affect enzyme activity.

  • Structure-Function Relationships: Determining the three-dimensional structure of N. hamburgensis UppP through crystallography or cryo-EM would allow for detailed understanding of its catalytic mechanism and could guide the development of specific inhibitors or engineered variants with enhanced properties.

  • Ecological Role: Field studies examining the expression and activity of UppP in natural Nitrobacter communities could reveal how this enzyme contributes to the bacterium's survival and competitiveness in soil environments. This could include studying UppP activity in response to environmental fluctuations such as changing nitrite concentrations, oxygen availability, and interactions with other soil microorganisms.

  • Metabolic Integration: Investigating how UppP activity is coordinated with other aspects of Nitrobacter metabolism, particularly the shift between autotrophic and heterotrophic growth modes, could provide insights into the bacterium's remarkable metabolic flexibility.

  • Biotechnological Applications: Exploring potential applications of recombinant UppP in biotechnology, such as its use in synthesizing modified cell wall precursors or developing screens for novel antibiotics that target bacterial cell wall synthesis.

  • Resistance Mechanisms: Further characterizing the role of UppP in antibiotic resistance beyond bacitracin could identify novel resistance mechanisms and potentially inform the development of new antimicrobial strategies targeting these soil bacteria or related pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.