Recombinant Nitrobacter winogradskyi ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Genomic and Metabolic Context

  • Genomic Annotation: The atpB gene is part of an operon encoding ATP synthase subunits, reflecting its essential role in energy metabolism .

  • Chemolithotrophic Growth: ATP synthase enables N. winogradskyi to oxidize nitrite (NO2_2^-) for energy, supporting carbon fixation via the Calvin cycle .

  • Heterotrophic Capabilities: In the absence of nitrite, atpB supports ATP synthesis during organic carbon metabolism (e.g., lactate oxidation) .

ATP Pool Dynamics

  • Nitrite Oxidation: ATP levels in N. winogradskyi drop by ~60% within 10 minutes of nitrite addition, stabilizing during exponential growth (20–40 pmol/5 µg cell-N) .

  • Energy Charge: Ranges from 0.37 (log phase) to 0.57 (stationary phase), indicating metabolic flexibility .

Stress Responses

  • Salinity Stress: Exposure to 30 mS cm1^{-1} salinity increases alkyl hydroperoxide reductase (Q3SSM2, Q3SP52) abundance, indirectly protecting ATP synthase from oxidative damage .

  • Acid Adaptation: Transcriptional upregulation of atpB enhances proton gradient maintenance under acidic conditions .

Comparative Analysis with Nitrobacter Hamburgensis atpB

FeatureN. winogradskyi atpB (Q3SW35)N. hamburgensis atpB (Q1QRH8)
Sequence Identity85%Reference
Key ResiduesVal15^{15}, Leu20^{20}Ile15^{15}, Met20^{20}
Expression HostE. coli E. coli
Functional DivergenceEnhanced lactate metabolism support Broader substrate versatility

Applications and Research Tools

  • Enzyme Mechanism Studies: Used to dissect proton translocation and rotational catalysis in ATP synthases .

  • Stress Response Models: Recombinant atpB aids in studying metabolic adaptations to salinity, pH, and oxidative stress .

  • Synthetic Biology: Serves as a template for engineering bioenergetic systems in synthetic microbial consortia .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB; Nwi_0238; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
atpB
Target Protein Sequence
MMDPIHQFNIEPIFTIGHIGGQEIAFTNSSAYMFLAVALTSLLMLGTGRRLVPGRMQSIA EISYEFVADTIRTTAGKEGMKFFPFVFSIFMLVTVSNLVGIIPYTFTISSHIIVTAALAF LVFFTVLIYGFYKNGLRFFKLFVPSGIPVVILPLVVTIEVISFLSRPVSHSVRLFANMLA GHITLKVFASFVTMLGAMGIVGVFGAVLPLALVVALTALELLVAFLQAYVFTILTCIYIN DAIHPGH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (atpB) in Nitrobacter winogradskyi and what role does it play in energy metabolism?

ATP synthase subunit a (atpB) is a critical component of the F1F0-ATP synthase complex in N. winogradskyi. This membrane-embedded protein forms part of the F0 sector and contains the proton channel necessary for coupling proton translocation to ATP synthesis. In N. winogradskyi, the ATP synthase complex plays a central role in energy conservation by utilizing the proton motive force generated during nitrite oxidation to synthesize ATP.

The genome sequence of N. winogradskyi (ATCC 25391) consists of a single circular chromosome of 3,402,093 bp encoding 3,143 predicted proteins . While the genome encodes multiple enzymes involved in energy conservation, the ATP synthase complex represents the final step in converting the electrochemical gradient into chemical energy in the form of ATP.

Research has demonstrated that in electron-transport particles from N. winogradskyi, energy-conserving reactions exhibit distinctive regulatory patterns, with ADP and phosphate inhibiting nitrite oxidation while stimulating NADH oxidation . This suggests a sophisticated regulatory mechanism controlling the electron transport chain and ATP synthesis coupling in this organism.

How does atpB structure and function in N. winogradskyi compare to homologous proteins in other bacteria?

The atpB protein in N. winogradskyi shares significant homology with other alphaproteobacteria, particularly Bradyrhizobium japonicum and Rhodopseudomonas palustris. Genomic analysis has revealed extensive similarities between N. winogradskyi and these organisms, with 1,300 and 815 similar genes respectively . This evolutionary relationship extends to energy conservation mechanisms, including components of the ATP synthase complex.

Given N. winogradskyi's specialized metabolism as a nitrite oxidizer, its ATP synthase likely contains adaptations that optimize performance under the unique bioenergetic conditions of nitrite oxidation. The electron transport chain in N. winogradskyi operates differently compared to heterotrophic bacteria, which affects how the proton gradient is established and utilized by ATP synthase.

Experimental work with electron-transport particles has demonstrated that in N. winogradskyi, the uncoupling agent carbonyl cyanide phenylhydrazone increases NADH oxidation rates while decreasing nitrite oxidation rates . This relationship reflects the tight coupling between electron transport and energy conservation mechanisms in which ATP synthase plays a central role.

What genomic evidence exists for the atpB gene in N. winogradskyi?

The complete genome sequencing of N. winogradskyi has provided valuable insights into its metabolic capabilities and energy conservation mechanisms. The genome contains genes encoding pathways for both lithotrophic and heterotrophic growth . The ATP synthase operon, including the atpB gene, would be expected to be present in this organism given its ability to perform oxidative phosphorylation.

Comparative genomic analysis of N. winogradskyi with other alphaproteobacteria has revealed extensive conservation of core metabolic functions, including energy metabolism genes . Based on genomic similarities with other alphaproteobacteria, the ATP synthase genes in N. winogradskyi likely share organizational features with related organisms, though with adaptations specific to its nitrite-oxidizing lifestyle.

The genome sequence serves as an essential resource for identifying and characterizing genes involved in energy metabolism, including ATP synthase components, and provides the foundation for molecular studies of these proteins.

What expression systems are most suitable for recombinant production of N. winogradskyi atpB?

When expressing recombinant N. winogradskyi atpB, researchers should consider several important factors influencing successful expression:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli pET systemHigh yield, easy handlingPotential membrane protein folding issuesLower induction temperature (16-20°C), use C41/C43 strains
Bacillus subtilisBetter for membrane proteinsLower yields than E. coliOptimize codon usage, use strong promoters
Cell-free systemsAvoids toxicity issuesHigher cost, limited scaleSupplement with lipids for membrane proteins
Yeast expressionPost-translational processingLonger cultivation timeUse inducible promoters, optimize pH

For optimal expression, researchers should consider using E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression. Cultivation conditions should include lower induction temperatures (16-20°C) and moderate inducer concentrations to promote proper folding of the membrane protein. Including additive phospholipids in the expression media may enhance proper membrane integration and folding.

When designing the expression construct, include appropriate affinity tags (His6 or Strep-tag) positioned to avoid interference with the proton channel function. Importantly, verify that the recombinant protein retains its native structure through functional assays measuring proton translocation capability.

What purification strategies maintain structural integrity of recombinant atpB?

Purifying membrane proteins like atpB presents significant challenges. Successful purification requires careful selection of detergents and buffers that maintain protein stability while efficiently extracting the protein from the membrane.

Purification StepRecommended ApproachCritical ParametersQuality Control
Membrane extractionMild detergents (DDM, LMNG)Detergent:protein ratio, temperatureProtein recovery assay
Affinity chromatographyIMAC for His-tagged proteinImidazole gradient, flow rateSDS-PAGE, Western blot
Size exclusionSuperdex 200 columnBuffer composition, pH stabilityOligomeric state analysis
Functional validationReconstitution into liposomesLipid composition, protein:lipid ratioProton pumping assay

The purification protocol should include stabilizing agents such as glycerol (10-15%) and appropriate salt concentrations (typically 150-300 mM NaCl) to maintain protein stability. Throughout purification, monitor protein stability using thermal shift assays and verify structural integrity through circular dichroism spectroscopy.

For functional studies, reconstitution into proteoliposomes provides a system to measure proton translocation activity. This can be assessed using pH-sensitive fluorescent dyes or direct pH measurements in response to an applied membrane potential.

How can researchers overcome expression challenges specific to N. winogradskyi membrane proteins?

Expression of membrane proteins from specialized bacteria like N. winogradskyi presents several unique challenges:

  • Codon optimization: Analyze the codon usage in the native atpB gene and optimize for the expression host to improve translation efficiency and protein yield.

  • Toxicity management: Express atpB under tightly controlled inducible promoters to prevent basal expression that might be toxic to the host cell.

  • Fusion partners: Consider using fusion partners that enhance protein solubility or membrane targeting, such as MBP (maltose-binding protein) or Mistic (membrane-integrating sequence for translation of integral membrane protein constructs).

  • Expression temperature optimization: Systematically test expression at different temperatures (37°C, 30°C, 25°C, 18°C) to determine optimal conditions for functional protein production.

When working with N. winogradskyi proteins, researchers should consider the unique physiological conditions of this organism, including pH preferences and growth temperature, which may influence protein stability and folding requirements. Incorporating these factors into expression and purification protocols can significantly improve recombinant protein quality.

How does atpB contribute to the energy conservation mechanisms in N. winogradskyi?

The ATP synthase complex, including the atpB subunit, plays a central role in the energy metabolism of N. winogradskyi. This chemolithoautotrophic bacterium derives energy from the oxidation of nitrite to nitrate via a nitrite oxidoreductase (NXR) . The electron transport chain generates a proton motive force that the ATP synthase utilizes for ATP synthesis.

Experimental studies with electron-transport particles from N. winogradskyi have revealed interesting relationships between nitrite oxidation and ATP synthesis. Notably, oligomycin (an ATP synthase inhibitor) stimulates nitrite oxidation while inhibiting NADH oxidation, suggesting a regulatory feedback mechanism between ATP synthesis and substrate oxidation .

In addition, a reversible uptake of H+ accompanies nitrite oxidation in electron-transport particles, demonstrating the direct connection between substrate oxidation and proton translocation . This proton gradient is then utilized by the ATP synthase complex, with the atpB subunit serving as a critical component of the proton channel.

What is the relationship between nitrite oxidation and ATP yield in N. winogradskyi?

The energetic efficiency of nitrite oxidation coupled to ATP synthesis in N. winogradskyi is a critical aspect of this organism's metabolism. Research has provided insights into ATP yield under different metabolic conditions:

Metabolic ConditionATP Yield (mmol ATP/mmol NO2-)Energy ModelReference
Standard NO2- oxidation0.667Simple model (NIR in periplasm only)
Enhanced energy coupling1.53Poughon model (NIR in periplasm and cytoplasm)

The Poughon model suggests that nitrite reductase (NIR) functioning in both cytoplasmic and periplasmic compartments contributes to improved ATP yield through enhanced proton translocation . This model proposes that NO2- is converted to NO in the periplasm, followed by NO diffusion into the cytoplasm where it is converted back to NO2-, and finally to NO3- by nitrite oxidoreductase (NXR) .

This complex arrangement results in increased net proton translocation from the cytoplasm to the periplasm, enhancing the proton gradient available for ATP synthesis through the ATP synthase complex . The atpB subunit, as part of the proton channel, directly interfaces with this proton gradient.

How do environmental factors affect atpB function and expression in N. winogradskyi?

Environmental conditions significantly impact energy metabolism in N. winogradskyi, with corresponding effects on ATP synthase function and expression:

  • Oxygen availability: N. winogradskyi has been studied under both aerobic and microaerobic conditions . Under oxygen limitation, the electron transport chain efficiency may be compromised, affecting the proton gradient and consequently ATP synthase function.

  • Nitrite concentration: As the primary energy substrate, nitrite availability directly influences electron transport and ATP synthesis rates. The apparent Km for nitrite in electron transport particles remains unaffected by uncouplers, ADP with Pi, or oligomycin, suggesting stable substrate affinity regardless of energetic state .

  • pH effects: The pH of the growth medium affects both nitrite oxidation and proton gradient formation. Experiments have demonstrated that NH4Cl or cyclohexylamine hydrochloride abolishes H+ uptake and increases nitrite oxidation rates, highlighting the relationship between proton movements and metabolic activity .

  • Alternative substrates: While primarily chemolithoautotrophic, N. winogradskyi demonstrates metabolic flexibility. The genome contains genes for both lithotrophic and heterotrophic growth, suggesting the organism can adjust its energy metabolism based on substrate availability .

Understanding these environmental influences is crucial for researchers working with recombinant atpB, as they may need to recreate appropriate conditions to study the protein's function in vitro.

What techniques can resolve the coupling mechanism between nitrite oxidation and ATP synthesis in N. winogradskyi?

Investigating the coupling mechanism between nitrite oxidation and ATP synthesis requires sophisticated methodological approaches:

TechniqueApplicationMeasurement ParametersAdvantages
Membrane vesicle studiesDirect measurement of proton translocationpH changes, membrane potentialMaintains native membrane environment
Isotope labelingTracking phosphate incorporation into ATP32P or 18O incorporation ratesQuantifies ATP synthesis directly
Site-directed mutagenesisIdentify critical residues in atpBEffects on proton conductance and ATP synthesisMechanistic insights at molecular level
Cryo-EM structural analysisResolve structure of ATP synthase complexHigh-resolution structural detailsVisualizes conformational states

Implementing these methodologies requires careful experimental design, particularly when working with membrane proteins from specialized organisms like N. winogradskyi, which may have unique environmental requirements for optimal function.

How can systems biology approaches integrate atpB function into models of N. winogradskyi metabolism?

Systems biology offers powerful frameworks for understanding atpB function within the broader context of N. winogradskyi metabolism. Genome-scale, constraint-based modeling approaches can integrate physicochemical, spatiotemporal, and environmental constraints into reaction networks that capture the material and energy processing activities of the organism .

For N. winogradskyi, researchers have developed integrative models that combine genome-scale metabolic reconstruction with dynamic flux balance analysis (dFBA). These models place steady-state constraint-based formalism within a discrete time step dynamic approximation using Michaelis-Menten kinetics to simulate nutrient uptake .

When modeling ATP synthase function, researchers should account for:

  • The stoichiometry of proton translocation to ATP synthesis

  • The relationship between nitrite oxidation rates and ATP production

  • Maintenance energy requirements (measured at 8-18.5 mmol ATP gDCW−1 h−1)

  • Regulatory feedback mechanisms between ATP levels and nitrite oxidation

What insights can structural studies of atpB provide about proton translocation in N. winogradskyi?

Structural studies of atpB can reveal critical insights into the molecular mechanisms of proton translocation in N. winogradskyi. While specific structural data for N. winogradskyi atpB is not currently available in the provided search results, targeted structural biology approaches could address several key questions:

  • Identification of amino acid residues forming the proton channel

  • Conformational changes associated with proton movement

  • Structural adaptations specific to nitrite-oxidizing bacteria

  • Interaction interfaces between atpB and other ATP synthase subunits

Researchers could employ cryo-electron microscopy to resolve the structure of the complete ATP synthase complex, complemented by site-directed spin labeling and electron paramagnetic resonance (EPR) spectroscopy to monitor conformational dynamics during proton translocation.

X-ray crystallography of individual subunits or subcomplexes would provide atomic-resolution information about key functional domains. Molecular dynamics simulations based on these structures could model proton movement through the channel and predict the effects of mutations or environmental changes on function.

How does N. winogradskyi atpB compare to homologous proteins in other nitrite-oxidizing bacteria?

Comparative analysis of ATP synthase components across nitrite-oxidizing bacteria provides evolutionary insights and functional context for N. winogradskyi atpB:

OrganismMetabolic ClassificationGenomic FeaturesATP Synthase Characteristics
N. winogradskyiChemolithoautotroph3.4 Mb genome, 3,143 proteinsSimilar to other alphaproteobacteria
N. hamburgensisChemolithoautotroph with heterotrophic capacityContains complete glycolysis pathway and unique electron transport componentsPotentially adapted for diverse energy sources
Related alphaproteobacteria (B. japonicum, R. palustris)Various metabolic strategiesExtensive gene similarities with N. winogradskyiEvolutionary relationship in energy conservation mechanisms

The genome of N. winogradskyi shares extensive similarities with other alphaproteobacteria, particularly Bradyrhizobium japonicum (1,300 genes) and Rhodopseudomonas palustris (815 genes) . This evolutionary relationship likely extends to ATP synthase components, including atpB.

Notably, different Nitrobacter species show metabolic diversity. While N. winogradskyi lacks genes for a complete glycolysis pathway and active transport of sugars, N. hamburgensis harbors these pathways along with unique electron transport components . These metabolic differences may be reflected in adaptations of their respective ATP synthase complexes to different energy sources.

What evolutionary adaptations in atpB might be specific to nitrite-oxidizing metabolism?

The specialized energy metabolism of nitrite-oxidizing bacteria like N. winogradskyi may have driven specific evolutionary adaptations in the ATP synthase complex, including the atpB subunit:

  • Optimized proton channel properties to accommodate the relatively low energy yield from nitrite oxidation

  • Regulatory features coordinating ATP synthesis with nitrite oxidation rates

  • Structural stability adaptations for the periplasmic pH conditions typical during nitrite oxidation

  • Potential specializations related to the unique electron transport chain components in nitrite oxidizers

Experimental evidence supports unique regulatory features in N. winogradskyi energy metabolism. Unlike typical respiratory control patterns, N. winogradskyi electron transport particles show a respiratory control ratio less than unity with nitrite as substrate, suggesting specialized regulatory mechanisms .

Additionally, the genome analysis of N. winogradskyi revealed two gene copies of cytochrome c oxidase , indicating potential adaptations in the electron transport chain that would influence ATP synthase function.

How does nitrogen metabolism influence ATP synthesis efficiency across different bacterial species?

Nitrogen metabolism and its coupling to energy conservation varies considerably across bacterial species, affecting ATP synthesis efficiency:

OrganismNitrogen TransformationEnergy YieldATP Synthesis Efficiency
N. winogradskyiNO2- → NO3-0.667-1.53 mmol ATP/mmol NO2-Depends on proton translocation efficiency
N. europaeaNH3 → NO2-Higher than nitrite oxidationMore exergonic reaction
Denitrifying bacteriaNO3- → N2Variable depending on electron donorMultiple ATP-generating steps

The energy yield from nitrite oxidation is relatively low compared to other metabolic processes, necessitating efficient energy coupling. In N. winogradskyi, the ATP yield can increase from 0.667 to 1.53 mmol ATP per mmol NO2- depending on the operation of nitrite reductase in both periplasmic and cytoplasmic compartments .

Interestingly, when N. winogradskyi and the ammonia-oxidizing bacterium N. europaea are cocultured, the production of nitrogen oxide gases is greater than from single cultures combined . This suggests complex interactions between different nitrogen-cycling processes that may influence energy conservation and ATP synthesis.

What are common challenges in expressing functional recombinant N. winogradskyi atpB and how can they be addressed?

Researchers working with recombinant N. winogradskyi atpB commonly encounter several challenges:

ChallengeManifestationSolution ApproachValidation Method
Protein misfoldingInclusion body formationLower induction temperature, use folding chaperonesMembrane fraction localization
Low expression yieldMinimal detectable proteinOptimize codon usage, use stronger promotersWestern blot quantification
Protein instabilityDegradation during purificationInclude protease inhibitors, optimize buffer conditionsSize-exclusion chromatography
Loss of functionPurified protein lacks activityGentle detergent extraction, lipid supplementationProton translocation assay

When troubleshooting expression issues, consider the specialized growth conditions of N. winogradskyi, which is typically cultured chemolithoautotrophically with nitrite as the electron donor . The expression host environment differs significantly from the native conditions, potentially affecting protein folding and stability.

Successful approaches often include fusion tags that enhance solubility or membrane targeting, expression at lower temperatures (16-20°C), and inclusion of osmolytes or stabilizing agents in growth media. For challenging membrane proteins like atpB, expression in specialized hosts such as C41/C43 E. coli strains or Lemo21(DE3) may significantly improve results.

How can researchers distinguish between effects of atpB and other energy-conserving mechanisms in N. winogradskyi?

Distinguishing the specific contribution of atpB to energy conservation in N. winogradskyi requires careful experimental design:

  • Selective inhibition: Use specific inhibitors like oligomycin that target ATP synthase without affecting other components of energy metabolism. In N. winogradskyi electron-transport particles, oligomycin inhibits NADH oxidation while stimulating nitrite oxidation .

  • Genetic approaches: Develop conditional knockdown systems for atpB to modulate expression levels and observe effects on energy conservation. Compare with knockdowns of other energy-related genes.

  • Reconstitution experiments: Purify individual components of the energy conservation system and reconstitute them in liposomes to measure their specific activities in isolation.

  • Comprehensive bioenergetic profiling: Measure membrane potential, pH gradient, ATP/ADP ratios, and oxygen consumption rates simultaneously to build a complete picture of energy flow.

  • Isotope labeling: Use isotope-labeled substrates to track the flow of electrons and energy through the system and quantify the contribution of different pathways.

These approaches can help decouple the effects of ATP synthase from other energy-conserving mechanisms, providing a clearer understanding of atpB's specific role.

What controls and validations are essential when studying recombinant atpB function?

Rigorous experimental design for recombinant atpB functional studies should include several essential controls and validations:

Control/Validation TypePurposeImplementationExpected Outcome
Negative controlConfirm specificity of observed effectsInactive atpB mutant (e.g., proton channel mutation)No proton translocation or ATP synthesis
Positive controlValidate assay functionalityWell-characterized ATP synthase (e.g., E. coli)Expected activity levels under standard conditions
Concentration dependenceEstablish dose-response relationshipTitration of protein concentrationLinear relationship within working range
Substrate specificityConfirm expected biochemical behaviorVarious nucleotides (ATP, GTP, CTP)Specificity for ATP/ADP
Environmental responseValidate physiological relevancepH, temperature, salt concentration variationsActivity profile matching native conditions

For structural validation, circular dichroism spectroscopy can confirm proper secondary structure formation. Functional validation should include proton translocation assays using pH-sensitive fluorescent dyes and ATP synthesis measurements under different conditions.

When reconstituting atpB or the complete ATP synthase complex into liposomes, controls for proper orientation and membrane integrity are critical. Researchers should verify that the protein-to-lipid ratio and lipid composition support native-like function.

How might CRISPR-Cas9 technology advance functional studies of atpB in N. winogradskyi?

CRISPR-Cas9 technology offers powerful approaches for advancing our understanding of atpB function in N. winogradskyi:

  • Precise genomic editing: Create targeted mutations in the atpB gene to study structure-function relationships. This could include systematic alanine scanning of putative proton channel residues or introduction of specific mutations identified in other organisms.

  • Conditional expression systems: Develop CRISPR interference (CRISPRi) systems to create conditional knockdowns of atpB, allowing temporal control over expression levels to study the immediate effects of reduced ATP synthase activity.

  • Reporter gene fusions: Insert fluorescent protein tags or other reporters at the genomic locus to monitor native expression levels and localization patterns under different growth conditions.

  • High-throughput mutagenesis: Implement CRISPR-based saturation mutagenesis libraries to comprehensively map functional domains and critical residues within atpB.

These approaches would be particularly valuable given that N. winogradskyi is a specialized organism with unique energy metabolism. Traditional genetic tools have been limited for many chemolithoautotrophic bacteria, and CRISPR technologies could overcome these limitations.

What potential applications exist for engineered variants of N. winogradskyi atpB?

Engineered variants of N. winogradskyi atpB could have several interesting research and potentially practical applications:

  • Bioenergetic probes: Develop atpB variants with modified proton conductance properties to investigate the fundamental mechanisms of proton translocation and energy conservation.

  • Synthetic biology platforms: Engineer strains with modified ATP synthase properties to optimize growth or production of value-added compounds linked to energy metabolism.

  • Bioremediation optimization: Create variants with altered efficiency to enhance the performance of Nitrobacter species in nitrification processes for wastewater treatment.

  • Biosensors: Develop atpB-based sensing systems that respond to changes in proton gradient or ATP levels as indicators of environmental conditions.

The distinctive properties of N. winogradskyi ATP synthase, adapted to function efficiently with the relatively low energy yield from nitrite oxidation, could provide unique insights for bioenergetic engineering in other systems.

How could integrative modeling approaches advance our understanding of atpB in cellular energetics?

Integrative modeling approaches offer powerful frameworks for understanding atpB function within the broader context of cellular energetics:

  • Multi-scale modeling: Combine molecular dynamics simulations of atpB proton translocation with genome-scale metabolic models to connect molecular mechanisms to whole-cell phenotypes.

  • Dynamic flux analysis: Implement dFBA modeling that includes detailed ATP synthase kinetics to predict how changes in environmental conditions affect energy conservation efficiency .

  • Comparative systems analysis: Develop models comparing energy conservation in different nitrite-oxidizing bacteria to identify common principles and unique adaptations.

  • Synthetic ecology models: Create integrative models of nitrifying communities (e.g., N. winogradskyi and N. europaea cocultures) to predict how interactions between different nitrogen-cycling processes affect ATP synthesis and energetics .

These modeling approaches can generate testable hypotheses about atpB function and regulation, guiding experimental design and providing a framework for interpreting experimental results in the context of whole-cell physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.