Recombinant Nitrobacter winogradskyi ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your desired tag type at the time of ordering for preferential development.
Synonyms
atpF2; atpG; Nwi_0236; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
atpF2
Target Protein Sequence
MAESHGNAHGATAHTEADGGHKAPFPPFQKETFASQLVSLTIAFVALYLISSRLALPRVR QTIDDRENTIKGDLAQAQKLKDDSDAALKAYEAELAAARARAQAIGNETREKLNAAAEAE RKALEERLSVKLADAEKTIASTRAAAMSNVRGIASDAATAIVQQLTGATPDSKLVDSAVD ASMKG
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. The b'-subunit is a component of the F(0) channel, forming part of the peripheral stalk that connects F(1) and F(0). This subunit represents a diverged and duplicated form of the b-subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the ATP synthase complex function in N. winogradskyi's energy metabolism?

In N. winogradskyi, ATP synthase plays a critical role in energy conservation during nitrite oxidation. The bacterium generates a proton motive force through the oxidation of nitrite to nitrate according to the reaction NO2− + H2O → NO3− + 2H+ + 2e− . This process involves:

  • Nitrite oxidation by nitrite oxidoreductase (NXR) in the periplasm

  • Transfer of electrons through the respiratory chain

  • Establishment of a proton gradient across the membrane

  • ATP synthesis by the F1F0-ATP synthase using this proton gradient

Energy models show that ATP yield can vary from 0.667 mmol ATP per mmol NO2− to 1.53 mmol ATP per mmol NO2− depending on the exact mechanism employed . The most complex model includes both periplasmic and cytoplasmic nitrite reductase activity, which increases ATP yield but also requires higher maintenance energy (18.5 mmol ATP gDCW−1 h−1 compared to 8 mmol ATP gDCW−1 h−1 in simpler models) .

What are the most effective methods for expressing and purifying recombinant N. winogradskyi atpG?

For successful expression and purification of recombinant N. winogradskyi ATP synthase subunit b/b' (atpG), researchers should consider the following protocol:

  • Expression system selection: E. coli BL21(DE3) is commonly used for heterologous expression of bacterial membrane proteins. Alternative systems include yeast (P. pastoris) for potentially better folding of membrane-associated proteins.

  • Vector design: Include:

    • A strong inducible promoter (T7 or tac)

    • An N-terminal or C-terminal affinity tag (6xHis or Strep-tag II)

    • A TEV protease cleavage site for tag removal

    • Codon optimization for the expression host

  • Culture conditions:

    • Growth at lower temperatures (16-25°C) after induction

    • Lower inducer concentrations (0.1-0.5 mM IPTG)

    • Supplementation with membrane-stabilizing compounds

  • Purification strategy:

    • Membrane solubilization with mild detergents (DDM, LMNG)

    • IMAC or Strep-Tactin chromatography

    • Size exclusion chromatography for final polishing

  • Quality control:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure assessment

The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles .

How can researchers assess the functional integrity of recombinant atpG in vitro?

Assessing the functional integrity of recombinant atpG requires evaluation of its ability to correctly associate with other ATP synthase subunits and participate in complex assembly. Recommended approaches include:

  • Reconstitution assays:

    • Combine purified atpG with other F0 components to assess complex formation

    • Use fluorescently labeled subunits to track interaction kinetics

    • Measure binding affinities through microscale thermophoresis or ITC

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine stability

  • Functional complementation:

    • Use atpG-deficient bacterial strains for in vivo complementation tests

    • Measure ATP synthesis rates in reconstituted proteoliposomes

    • Monitor proton translocation using pH-sensitive fluorescent dyes

  • Interaction mapping:

    • Perform crosslinking experiments to verify correct positioning

    • Use FRET-based assays to measure distances between subunits

    • Apply hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

These techniques provide comprehensive validation of the recombinant protein's structural and functional properties, ensuring its suitability for downstream applications.

How does atpG expression change under different growth conditions in N. winogradskyi?

The expression of ATP synthase components, including atpG, in N. winogradskyi varies significantly in response to environmental conditions. Key patterns include:

Growth ConditionEffect on atpG ExpressionAssociated Metabolic ChangesReference
High NH4+ (25 mM)Differential regulationUpregulation of post-translational modification, protein turnover, biogenesis and chaperones
Co-culture with N. europaeaDecreased abundance of ATP synthase F1 complex proteins (subunits α, β, γ, and δ)Changes in energy generation efficiency
Different energy models (after 3h growth)Shift in ATP yield from 0.667 to 1.53 mmol ATP per mmol NO2-Increased maintenance energy requirement (from 8 to 18.5 mmol ATP gDCW-1 h-1)
Exposure to high salinity (30 mS cm-1)Changes in ROS-related enzymesModifications to energy metabolism

These expression patterns indicate that ATP synthase regulation is tightly linked to the organism's adaptation to changing environmental conditions, particularly in response to nitrogen availability and oxidative stress .

What is the relationship between atpG function and nitrite oxidation in N. winogradskyi?

The ATP synthase complex, including the atpG subunit, is integrally connected to nitrite oxidation in N. winogradskyi through energetic coupling. This relationship involves:

  • Energetic linkage: Nitrite oxidation generates a proton gradient that drives ATP synthesis through the F1F0-ATP synthase complex .

  • Metabolic regulation: The ATP yield from nitrite oxidation varies with different metabolic models, suggesting adaptive regulation of ATP synthase activity .

  • Reverse functionality: Under certain conditions, ATP synthase may operate in reverse, hydrolyzing ATP to maintain membrane potential when nitrite is limited.

  • Coordination with NXR: The cytoplasmic nitrite oxidoreductase (NXR) in N. winogradskyi works in concert with ATP synthase to maximize energy conservation .

  • Quorum sensing influence: QS signaling affects nitrogen metabolism genes, indirectly influencing the energetic demands met by ATP synthase .

The tight coupling between nitrite oxidation and ATP synthesis via ATP synthase makes atpG function critical for N. winogradskyi's chemolithoautotrophic lifestyle and ecological role in the nitrogen cycle .

How does N. winogradskyi atpG differ from equivalent subunits in other nitrite-oxidizing bacteria?

N. winogradskyi atpG shows both conservation and divergence when compared to equivalent subunits in other nitrite-oxidizing bacteria:

OrganismATP Synthase CharacteristicsKey Differences from N. winogradskyiEvolutionary Implications
Nitrospira moscoviensisPeriplasmic NXR, different energy conservationDifferent coupling mechanism between nitrite oxidation and ATP synthesisReflects separate evolutionary lineage of Nitrospira-like NOB
Nitrobacter hamburgensisHighly similar ATP synthase genesMinor sequence variations reflecting close phylogenetic relationshipRecent divergence within Nitrobacter genus
Nitrospina gracilisDistinct delta-proteobacterial ATP synthaseDifferent subunit composition and membrane arrangementIndependent evolution of nitrite oxidation

How do interactions with other bacteria affect ATP synthase expression in N. winogradskyi?

Interactions with other bacteria significantly influence ATP synthase expression in N. winogradskyi through various mechanisms:

  • Co-culture with ammonia-oxidizing bacteria: When cultured with Nitrosomonas species, N. winogradskyi shows changes in ATP synthase component abundance, reflecting adaptation to the coupled nitrification process .

  • Quorum sensing effects: The production of acyl-homoserine lactones (C10-HSL and C10:1-HSL) by N. winogradskyi suggests that ATP synthase expression may be regulated by cell density through quorum sensing mechanisms .

  • Competition with heterotrophic bacteria: In enrichment cultures or environmental samples, heterotrophic bacteria create selective pressures that influence N. winogradskyi energy metabolism and ATP synthase optimization .

  • Microbial community assembly: Studies show that N. winogradskyi-selected microbiomes exhibit stochastic assembly processes, suggesting complex interspecies interactions that affect energy metabolism gene expression .

  • Syntrophic relationships: N. winogradskyi can establish metabolic dependencies with other organisms that influence ATP requirements and synthase expression .

These interactions represent important ecological factors that must be considered when studying ATP synthase function in natural environments versus pure cultures .

How can atpG be used as a target for studying energy metabolism in chemolithoautotrophic bacteria?

ATP synthase subunit b/b' (atpG) provides a valuable experimental target for investigating the unique energy metabolism of chemolithoautotrophic bacteria like N. winogradskyi:

  • Site-directed mutagenesis studies: Creating specific mutations in atpG can help determine:

    • Critical residues for proton translocation coupling

    • Structural elements required for assembly with F1 sector

    • Adaptation mechanisms to low-energy substrate utilization

  • Comparative bioenergetics: By analyzing atpG function across:

    • Different nitrite oxidizers (Nitrobacter vs. Nitrospira)

    • Various chemolithoautotrophic metabolisms

    • Facultative vs. obligate chemolithoautotrophs
      Researchers can identify convergent and divergent energy conservation strategies.

  • Metabolic engineering applications:

    • Optimizing ATP synthesis efficiency for biotechnological applications

    • Engineering strains with altered energy metabolism for enhanced nitrite oxidation

    • Creating reporter systems based on ATP synthesis activity

  • Structural biology insights: Determining the structure of the complete F1F0-ATP synthase complex with focus on the b/b' subunits would reveal how these bacteria have adapted their energy conservation mechanisms to low-energy substrates like nitrite.

  • In situ studies: Developing antibodies or other detection methods for atpG allows tracking of ATP synthase expression in environmental samples, providing insights into the energetic status of nitrite oxidizers in natural systems.

What are the implications of ATP synthase research for understanding N. winogradskyi's ecological role in nitrification?

Research on ATP synthase in N. winogradskyi has significant implications for understanding its ecological role in nitrification processes:

  • Energy limitation in natural environments: ATP synthase efficiency determines N. winogradskyi's competitive ability under energy-limited conditions, influencing community structure in nitrifying environments .

  • Response to environmental stressors: Changes in ATP synthase expression and activity reveal adaptation mechanisms to environmental challenges like:

    • Ammonium concentration fluctuations

    • Salinity stress

    • Oxygen limitation

    • Competitor organisms

  • Biofilm formation and persistence: ATP energy availability influences N. winogradskyi's ability to form biofilms and persist in engineered systems like wastewater treatment plants .

  • Coupling with ammonia oxidizers: The efficiency of ATP synthase affects the tight metabolic coupling between ammonia-oxidizing and nitrite-oxidizing communities:

    • N. europaea-N. winogradskyi interactions show changes in ATP synthase subunit abundance

    • Energy conservation efficiency influences the stoichiometry of the complete nitrification process

  • Climate impact: ATP synthase function indirectly affects the production of nitrogen oxide gases (NO, NO2, and N2O) through energy availability for cellular processes, with quorum sensing showing links between energy metabolism and nitrogen oxide emissions .

Understanding these relationships provides insights into both natural nitrogen cycling and applications in wastewater treatment, agriculture, and environmental management.

What novel approaches could improve structural understanding of N. winogradskyi ATP synthase?

Future research on N. winogradskyi ATP synthase structure could benefit from these emerging approaches:

  • Cryo-electron microscopy: Using single-particle cryo-EM to determine high-resolution structures of the intact ATP synthase complex, with specific focus on the arrangement of the b/b' subunits in relation to other components.

  • Integrative structural biology: Combining:

    • X-ray crystallography of individual subunits

    • NMR studies of domain dynamics

    • Cross-linking mass spectrometry

    • Molecular dynamics simulations
      to build a comprehensive structural model.

  • In situ structural techniques:

    • Cryo-electron tomography of N. winogradskyi cells

    • Super-resolution microscopy with labeled ATP synthase components

    • Correlative light and electron microscopy

  • Time-resolved structural studies: Capturing conformational changes during the catalytic cycle using:

    • Time-resolved cryo-EM

    • FRET-based sensors

    • EPR spectroscopy with site-directed spin labeling

  • Comparative structural genomics: Systematic comparison of ATP synthase structures across diverse nitrite oxidizers to identify adaptation mechanisms specific to different energetic constraints and ecological niches.

These approaches would provide unprecedented insights into how N. winogradskyi has adapted its ATP synthase for efficient energy conservation from nitrite oxidation.

How might ATP synthase research inform biotechnological applications of N. winogradskyi?

ATP synthase research in N. winogradskyi could enable several biotechnological applications:

  • Enhanced wastewater treatment:

    • Engineering N. winogradskyi strains with optimized ATP synthase efficiency

    • Designing bioreactors based on energy conservation principles

    • Monitoring ATP synthase activity as a biomarker for nitrification performance

  • Bioremediation applications:

    • Utilizing N. winogradskyi in nitrite-contaminated environments

    • Enhancing stress tolerance through ATP synthase modifications

    • Developing strains with improved survival under fluctuating conditions

  • Biosensor development:

    • Creating nitrite biosensors based on ATP synthesis activity

    • Developing environmental monitoring tools for nitrification processes

    • Engineering reporter systems for ecological studies

  • Biofilm engineering:

    • Manipulating ATP availability to control biofilm formation

    • Creating stable mixed-culture biofilms for continuous nitrification

    • Optimization of immobilized cell systems for water treatment

  • Bioenergy applications:

    • Utilizing the chemiosmotic coupling principles for bio-inspired energy systems

    • Developing microbial fuel cells incorporating nitrifying bacteria

    • Exploring the reverse operation of ATP synthase for hydrogen production

These applications would benefit from deeper understanding of ATP synthase structure, regulation, and function in N. winogradskyi, particularly in understanding how this organism balances energy conservation with metabolic demands under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.