Recombinant Nitrobacter winogradskyi Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

Nitrobacter winogradskyi is a chemolithotrophic bacterium that contributes to the nitrogen cycle by oxidizing nitrite into nitrate . It resides in various environments, including soil, freshwater, and saltwater . Understanding the function and properties of its cellular components is important for comprehending its role in the environment and potential biotechnological applications . Among these components is the large-conductance mechanosensitive channel (MscL), a protein that responds to mechanical stimuli in the cell membrane .

Mechanosensitive Channels (MscL)

Mechanosensitive channels like MscL are integral membrane proteins that respond to mechanical forces such as membrane stretching or pressure . These channels open in response to such stimuli, allowing ions and small molecules to pass through the membrane . This function is crucial for maintaining cellular homeostasis, especially under osmotic stress .

MscL in Nitrobacter winogradskyi

While specific research on the recombinant Nitrobacter winogradskyi MscL is limited, understanding MscL function in bacteria generally provides a framework. MscL channels are found in various bacterial species, and their role in stress response is well-documented .

Significance of Recombinant MscL

Recombinant production of MscL allows for detailed study of its structure and function . By expressing the N. winogradskyi MscL gene in a heterologous system, researchers can produce large quantities of the protein for biochemical and biophysical analyses. This approach is essential for:

  1. Structural studies: Determining the 3D structure of MscL using techniques like X-ray crystallography or cryo-electron microscopy.

  2. Functional assays: Investigating the channel's gating mechanism, ion selectivity, and response to different stimuli.

  3. Drug discovery: Identifying compounds that can modulate MscL activity, which could have implications for developing new antibacterial agents .

MscL as an Antibacterial Target

The mechanosensitive channel MscL can be a target for antibacterial compounds . The activation of MscL underlies the membrane permeabilization effect of the antibiotic compound SCH-79797 and its derivative IRS-16 . Mutational analysis has identified specific residues within the MscL channel that alter the response to treatment with antibacterial compounds, suggesting these residues are near the binding pocket .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
mscL; Nwi_1928; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
mscL
Target Protein Sequence
MWKEFREFAMKGNVVDLAVGVIIGAAFGGIVSSMVADIIMPIVGAVTGGLDFSNYFLPLS ESVNASNLSDAKKQGAVLAWGNFLTLTLNFLIVAFVLFMVIKGMNRLKRKDEAASAEPPK PTREEELLTEIRDLLKAKV
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrobacter winogradskyi and why is it significant for MscL research?

Nitrobacter winogradskyi is a chemolithotrophic bacterium that plays a crucial role in the nitrogen cycle by oxidizing nitrite to nitrate . This bacterium belongs to the family Bradyrhizobiaceae and is closely related to various Rhizobiales group members . N. winogradskyi has gained attention in MscL research because:

  • It serves as a model nitrite-oxidizing bacterium (NOB) due to its superior growth rate, nitrite tolerance, and growth yield compared to other NOBs .

  • The bacterium contains cell signaling mechanisms, including quorum sensing via N-acyl-homoserine lactones (acyl-HSLs) , which may influence channel expression and regulation.

  • As a chemolithoautotroph growing in varying osmotic conditions, it represents an interesting model for studying mechanosensitive channel function in specialized bacterial physiology.

Understanding MscL in N. winogradskyi provides insights into how these channels function in environmentally significant bacteria that must adapt to changing osmotic conditions in soil and aquatic environments.

What are mechanosensitive channels of large conductance (MscL) and what is their physiological role?

Mechanosensitive channels of large conductance (MscL) function as emergency release valves that discharge cytoplasmic solutes when bacteria experience decreases in osmotic environment . Key characteristics of MscL include:

  • They open the largest gated pore known in biological systems, passing molecules up to 30 Å in diameter .

  • MscL has an extremely large conductance of 3.6 nS, which is 1-2 orders of magnitude larger than most eukaryotic channels .

  • The channel responds directly to membrane tension caused by osmotic shifts, serving as a last-ditch protection mechanism against cell lysis.

The physiological significance of MscL stems from its critical role in bacterial osmoregulation. When bacteria encounter hypoosmotic shock, water rapidly enters the cell, increasing turgor pressure and threatening cell integrity. MscL channels open in response to the resulting membrane tension, allowing the rapid efflux of small cytoplasmic molecules and ions, thus preventing cell rupture during extreme osmotic downshifts.

How is the expression of MscL typically regulated in bacteria?

MscL expression in bacteria is regulated through several mechanisms:

  • Osmotic stress response: Expression is often upregulated during osmotic stress conditions, particularly hyperosmotic stress that may precede potential hypoosmotic shock.

  • Growth phase-dependent regulation: In many bacteria, MscL expression patterns correlate with growth phases, similar to how N. winogradskyi produces acyl-HSLs in a cell-density and growth phase-dependent manner .

  • Quorum sensing systems: In N. winogradskyi, which possesses a functional acyl-HSL synthase, quorum sensing may play a role in regulating stress response genes including mechanosensitive channels. The bacterium produces two distinct acyl-HSLs (C10-HSL and C10:1-HSL) in patterns that correlate with cell density and growth phase .

  • Transcriptional regulation: MscL gene expression can be influenced by global transcriptional regulators that respond to membrane stress and other environmental cues.

Understanding these regulatory mechanisms in N. winogradskyi specifically would require targeted gene expression studies under various osmotic conditions.

What are the optimal conditions for culturing N. winogradskyi for recombinant protein expression?

Optimal culturing conditions for N. winogradskyi recombinant protein expression require careful consideration of both growth parameters and expression induction:

Growth Parameters for N. winogradskyi:

ParameterOptimal ConditionNotes
Temperature28-30°CGrowth rate significantly decreases outside this range
pH7.5-8.2Maintains optimal nitrite oxidation activity
Nitrite concentration5-25 mMHigher concentrations can be inhibitory
Dissolved oxygen>4 mg/LEnsure adequate aeration as N. winogradskyi is an obligate aerobe
Growth phase for harvestLate exponentialBased on correlation with native protein expression patterns

Culture Methods:

  • Pure cultures of N. winogradskyi can be maintained in stirred and aerated bioreactors of different volumes .

  • For scale-up, fixed-bed bioreactors filled with Biostyr® beads have been successful for growing N. winogradskyi in axenic conditions .

  • Monitor growth by measuring nitrite oxidation rates, as the maximal growth rate in suspended cultures is approximately 0.022 h⁻¹ for N. winogradskyi .

For recombinant protein expression specifically, carefully evaluate the choice of promoter system, considering that native quorum sensing mechanisms may influence expression timing. Induction parameters should be optimized empirically, as the slow growth rate of N. winogradskyi (compared to E. coli) necessitates extended expression periods.

How can we design multifactorial experiments to optimize recombinant MscL expression in N. winogradskyi?

Designing multifactorial experiments for optimizing recombinant MscL expression in N. winogradskyi requires a systematic approach:

Remember that multifactorial designs require relatively homogeneous experimental units. Pre-screen N. winogradskyi cultures to ensure consistent baseline growth characteristics before assigning treatment combinations .

What methods are most effective for confirming successful MscL expression in N. winogradskyi?

Multiple complementary methods should be employed to confirm successful MscL expression in N. winogradskyi:

  • Western blot analysis:

    • Incorporate an epitope tag (His, FLAG, etc.) to the recombinant MscL

    • Use membrane fraction preparation protocols optimized for N. winogradskyi

    • Compare band intensity against known standards for quantification

  • Functional assays:

    • Hypoosmotic shock survival assays comparing recombinant strains with controls

    • Patch-clamp electrophysiology to directly measure channel conductance (3.6 nS is characteristic of MscL)

    • Fluorescent dye release assays using calcein-loaded cells subjected to hypoosmotic shock

  • Localization studies:

    • Immunofluorescence microscopy using antibodies against the epitope tag

    • For detailed localization, combine with specific detection techniques similar to those used for Nitrobacter detection in environmental samples

    • GFP fusion constructs can be used if expression levels are sufficient

  • RT-qPCR:

    • Design primers specific to the recombinant MscL sequence

    • Quantify expression levels under different conditions

    • Compare expression patterns with known N. winogradskyi genes like nwiI and nwiR that show cell-density and growth phase-dependent expression

When reporting expression confirmation, present multiple lines of evidence. For example, combine protein detection (Western blot) with functional assays to demonstrate not only the presence but also the proper folding and function of the recombinant MscL channel.

How should researchers analyze electrophysiological data from recombinant MscL channels in N. winogradskyi?

Electrophysiological analysis of recombinant MscL in N. winogradskyi requires specific approaches to extract meaningful results:

  • Conductance measurement and analysis:

    • MscL should display a characteristic large conductance of approximately 3.6 nS

    • Compare data with established MscL conductance parameters from E. coli or other model systems

    • Analyze channel gating threshold relative to membrane tension using the following relationship:

      Popen=11+eα(γγ1/2)P_{open} = \frac{1}{1 + e^{-\alpha(γ-γ_{1/2})}}

      Where P_{open} is the probability of channel opening, γ is membrane tension, γ_{1/2} is tension at which P_{open}=0.5, and α is the slope factor.

  • Single-channel recording interpretation:

    • Identify subconductance states, which are characteristic of MscL

    • Analyze dwell times in each conductance state

    • Compare kinetic parameters with published values for MscL from other species

  • Stimulus-response relationship:

    • Plot channel opening probability against membrane tension

    • Determine if recombinant MscL in N. winogradskyi shows altered gating tension compared to native bacterial sources

    • Assess if the nitrite-oxidizing lifestyle of N. winogradskyi influences channel sensitivity

  • Statistical analysis considerations:

    • Use non-parametric tests when comparing gating parameters across different experimental conditions

    • For patch-clamp data with multiple channels, employ specialized statistical treatments accounting for channel cooperativity

    • Calculate confidence intervals for all key parameters, particularly gating tension thresholds

When interpreting electrophysiological data, consider how the lipid composition of N. winogradskyi's membrane might differ from model organisms typically used for MscL studies, as membrane properties significantly influence mechanosensitive channel function.

What are the common pitfalls in data interpretation when studying MscL function in nitrite-oxidizing bacteria?

Several common pitfalls affect data interpretation when studying MscL function in nitrite-oxidizing bacteria like N. winogradskyi:

  • Confounding physiological variables:

    • Nitrite concentration affects membrane potential and may indirectly alter MscL gating properties

    • Growth phase influences membrane composition, which can affect MscL function

    • Quorum sensing mechanisms in N. winogradskyi may interact with stress response pathways regulating MscL

  • Technical challenges:

    • Low expression levels may lead to false negatives in detection

    • Contamination with heterotrophic bacteria can obscure results, requiring specialized techniques like those employing fluorescent antibodies specific to Nitrobacter species

    • Slow growth rate (0.022 h⁻¹) necessitates extended experimental timeframes, increasing variability

  • Comparison with inappropriate reference data:

    • Direct comparison with E. coli MscL data may be misleading due to differences in membrane composition

    • Studies often fail to account for the specialized metabolism of N. winogradskyi as a chemolithoautotroph

  • Statistical interpretation errors:

    • Small sample sizes due to technical difficulties with N. winogradskyi culturing

    • When testing multiple experimental conditions, there's a risk of finding significant results by chance

    • Clustered designs where practices implement the alternatives but patient-level outcomes are analyzed have statistical power depending primarily on the number of practices

To avoid these pitfalls, implement rigorous controls, use multiple complementary techniques for confirmation, and design experiments that specifically account for the unique physiology of nitrite-oxidizing bacteria.

How can researchers distinguish between native and recombinant MscL activity in experimental systems?

Distinguishing between native and recombinant MscL activity requires careful experimental design and specialized analytical approaches:

  • Genetic approaches:

    • Create knockout mutants of native MscL-like genes in N. winogradskyi before introducing recombinant constructs

    • Use CRISPR-Cas9 or traditional homologous recombination techniques for gene disruption

    • Sequence verification of both knockout and recombinant insertion sites

  • Protein differentiation strategies:

    • Incorporate epitope tags or fluorescent proteins into recombinant MscL

    • Design recombinant MscL with slightly altered conductance properties through point mutations

    • Express MscL from evolutionarily distant bacteria with distinctive electrophysiological signatures

  • Analytical differentiation:

    • Employ immunoprecipitation with tag-specific antibodies followed by mass spectrometry

    • Use size-exclusion chromatography if the recombinant channel has altered oligomeric state

    • Analyze subconductance states in electrophysiological recordings, which may differ between native and recombinant channels

  • Expression pattern analysis:

    • Control recombinant expression with inducible promoters not responsive to natural cues

    • Monitor expression under conditions where native channels would be downregulated

    • Exploit the natural quorum sensing system of N. winogradskyi to create opposing expression patterns

  • Comparative electrophysiology:

    ParameterNative MscLRecombinant MscLMethod of Distinction
    Gating thresholdBaseline valueAltered by mutationsPatch-clamp under controlled pressure
    ConductanceNative valuePotentially differentSingle-channel recording
    Pharmacological responseWild-type profileEngineered sensitivityResponse to specific compounds
    Subconductance statesSpecies-specific patternAltered patternHigh-resolution electrophysiology

When publishing results, clearly document the methods used to distinguish native from recombinant activity and include appropriate controls demonstrating the specificity of your detection methods.

How might the quorum sensing system of N. winogradskyi interact with MscL expression and function?

The quorum sensing (QS) system of N. winogradskyi involves N-acyl-homoserine lactone (acyl-HSL) signaling, which could interact with MscL expression and function through several mechanisms:

  • Potential regulatory interactions:

    • N. winogradskyi produces two distinct acyl-HSLs (C10-HSL and C10:1-HSL) in a cell-density and growth phase-dependent manner

    • The genome contains genes encoding a putative acyl-HSL autoinducer synthase (nwiI) and receptor (nwiR) with amino acid sequences 38-78% identical to those in Rhodopseudomonas palustris and other Rhizobiales

    • QS systems often regulate stress response genes, potentially including mechanosensitive channels

  • Experimental approaches to investigate interactions:

    • Create reporter constructs linking MscL promoter regions to fluorescent proteins

    • Test MscL expression in nwiI or nwiR knockout mutants

    • Supplement growth media with synthetic acyl-HSLs at varying concentrations

    • Perform chromatin immunoprecipitation to detect potential binding of NwiR to MscL promoter regions

  • Physiological implications:

    • QS may coordinate population-level responses to osmotic challenges

    • Cell-density dependent regulation could link nitrogen metabolism to osmoregulation

    • Biofilm formation (potentially regulated by QS) alters local osmotic environments

  • Research model:
    Establish experiments examining MscL expression across growth phases, correlating with natural acyl-HSL production patterns. Use the following experimental conditions:

    Growth PhaseExpected Acyl-HSL LevelsHypothesis for MscL ExpressionExperimental Approach
    Early logLowBaseline expressionRT-qPCR, Western blot
    Mid logIncreasingPotential upregulationRT-qPCR, Western blot, patch-clamp
    Late logHighMaximum modulationComprehensive analysis
    StationarySustained highPotential downregulationAll methods plus osmotic challenge tests

This research direction represents an unexplored intersection between bacterial communication systems and mechanosensitive channel regulation, potentially revealing new paradigms in bacterial adaptation strategies.

What are the structural and functional differences between MscL in N. winogradskyi and well-characterized MscL channels from model organisms?

Comparing MscL in N. winogradskyi to well-characterized channels from model organisms reveals important structural and functional differences:

  • Sequence and structural analysis:

    • Perform comprehensive sequence alignment of N. winogradskyi MscL with channels from E. coli, M. tuberculosis, and other species

    • Identify conserved features including the N-h-h-D motif, where "h" represents hydrophobic amino acids, which is found in many channel families

    • Analyze the transmembrane domains and the critical "slide helix" or "knot in a rope" at the cytoplasmic membrane boundary that guides transmembrane movements

  • Key functional regions to compare:

    • Membrane-spanning domains that detect tension

    • Pore-lining residues that determine conductance

    • Subunit interfaces that, when disrupted, can cause inappropriate channel gating

    • Cytoplasmic domains potentially involved in regulation

  • Functional comparisons:

    • Gating threshold relative to membrane tension

    • Channel conductance (typically 3.6 nS for canonical MscL)

    • Selectivity for ions and small molecules

    • Response to pharmacological modulators

  • Evolutionary context:

    • N. winogradskyi belongs to the family Bradyrhizobiaceae within Rhizobiales

    • Analyze how MscL has evolved in this specific bacterial lineage

    • Consider co-evolution with the specialized nitrite-oxidizing metabolism

This comparative analysis will provide insights into how mechanosensitive channels adapt to specific bacterial physiologies and environmental niches, potentially revealing novel structural features with implications for channel engineering applications.

What potential biotechnological applications could arise from studying recombinant MscL in N. winogradskyi?

Studying recombinant MscL in N. winogradskyi opens several promising biotechnological applications:

  • Bioremediation enhancement:

    • Engineered N. winogradskyi with modified MscL could show improved survival in variable environments during nitrification processes

    • Applications in wastewater treatment systems with fluctuating osmotic conditions

    • Potential for creating osmotically robust strains for environmental bioremediation of nitrogen-contaminated sites

  • Biosensor development:

    • MscL-based biosensors for detecting osmotic fluctuations in environmental samples

    • Integration with N. winogradskyi's nitrite-oxidizing capabilities for dual-function biosensors

    • Development of whole-cell biosensors for environmental monitoring

  • Drug delivery and screening platforms:

    • Modified MscL can serve as a triggered nanovalve in nanodevices for drug targeting

    • The large pore size of MscL (passing molecules up to 30 Å in diameter) makes it attractive for controlled release applications

    • Potential screening platform for compounds that modulate mechanosensitive channels

  • Novel antimicrobial strategies:

    • MscL has been identified as a valid drug target

    • Recombinant systems can be used to screen for compounds that inappropriately trigger channel opening

    • Studies with the antibiotic streptomycin have shown that it opens MscL and uses it as one of the primary paths to the cytoplasm

  • Research applications in mixed bacterial communities:

    • Understanding osmotic regulation in nitrite-oxidizing bacteria provides insights into microbial ecology

    • Models for studying bacterial interactions in nitrifying communities

    • Potential for engineering optimized nitrification consortia for wastewater treatment

The multifaceted applications stemming from this research converge on improving our understanding of bacterial osmoregulation while leveraging the specific ecological niche of N. winogradskyi in the nitrogen cycle.

How can researchers design experiments to investigate the role of MscL in N. winogradskyi's adaptation to varying osmotic environments?

Designing experiments to investigate MscL's role in N. winogradskyi's osmotic adaptation requires a comprehensive approach:

  • Growth and survival assays under osmotic challenge:

    • Compare wild-type, MscL knockout, and recombinant MscL-expressing strains

    • Subject cultures to both acute and gradual osmotic shifts

    • Measure survival rates, recovery times, and growth kinetics post-shock

    • Design a multifactorial experiment testing multiple variables simultaneously

  • Molecular and cellular responses:

    • Monitor MscL expression using RT-qPCR and Western blotting across osmotic conditions

    • Analyze global transcriptional responses using RNA-Seq

    • Measure solute accumulation/release during osmotic transitions

    • Assess membrane integrity using fluorescent probes

  • Physiological impact on nitrite oxidation:

    • Measure nitrite oxidation rates before, during, and after osmotic challenges

    • Determine the correlation between MscL function and maintenance of nitrite oxidation capacity

    • Investigate potential connections between nitrogen metabolism and osmoregulation

  • Experimental design matrix:

    Experiment TypeControl GroupTest GroupsMeasurementsAnalysis Method
    Acute hypoosmotic shockWild-type N. winogradskyiMscL knockout; MscL overexpressionSurvival %; Nitrite oxidation rateANOVA with post-hoc tests
    Gradual osmotic transitionWild-type N. winogradskyiMscL knockout; MscL overexpressionGrowth rate; Gene expression profileTime-series analysis
    Long-term adaptationWild-type N. winogradskyiMscL knockout; MscL overexpressionMorphological changes; Stable nitrite oxidation capacityMultiple regression
    Mixed culture competitionPure culturesMixed wild-type and mutant strainsPopulation dynamics; Competitive fitnessMathematical modeling
  • Advanced methodological considerations:

    • Use microfluidic devices to control precise osmotic transitions

    • Employ single-cell techniques to characterize population heterogeneity in responses

    • Implement live-cell imaging to visualize cellular responses in real-time

    • Apply isotope labeling to track metabolic shifts during osmotic adaptation

This experimental framework will provide comprehensive insights into how MscL contributes to N. winogradskyi's ecological fitness in environments with variable osmotic conditions, particularly in the context of its specialized role in the nitrogen cycle.

What are the most common obstacles in expressing functional recombinant MscL in N. winogradskyi and how can they be overcome?

Researchers face several challenges when expressing functional recombinant MscL in N. winogradskyi, each requiring specific strategies:

  • Low transformation efficiency:

    • Problem: N. winogradskyi, like many specialized bacteria, may have low competence for DNA uptake

    • Solution: Optimize electroporation parameters specifically for N. winogradskyi; consider using conjugation with helper strains; develop specialized transformation protocols based on those used for related Rhizobiales

  • Protein misfolding or aggregation:

    • Problem: Recombinant MscL may not fold properly in N. winogradskyi's membrane environment

    • Solution: Include appropriate signal sequences; co-express molecular chaperones; lower expression temperature to 25°C; consider fusion partners that enhance membrane integration

  • Toxicity of overexpressed MscL:

    • Problem: Excessive or leaky MscL expression can disrupt membrane integrity

    • Solution: Use tightly regulated inducible promoters; titrate inducer concentrations; consider growth phase-dependent expression systems based on N. winogradskyi's native regulatory elements

  • Low expression levels:

    • Problem: Poor yield of functional protein despite successful transformation

    • Solution: Optimize codon usage for N. winogradskyi; test multiple promoter systems; use stronger ribosome binding sites; consider the cell-density dependent expression patterns observed with native proteins

  • Difficult detection and characterization:

    • Problem: Challenges in confirming expression and function

    • Solution: Incorporate epitope tags; develop N. winogradskyi-specific membrane preparation protocols; adapt osmotic shock survival assays to the slow growth rate of this organism (0.022 h⁻¹)

The systematic approach to overcoming these obstacles must acknowledge N. winogradskyi's specialized metabolism and slower growth compared to traditional host organisms. Document troubleshooting steps meticulously, as optimized protocols will benefit the broader research community working with nitrite-oxidizing bacteria.

How can researchers effectively integrate computational modeling with experimental approaches when studying MscL in N. winogradskyi?

Effective integration of computational modeling with experimental approaches for studying MscL in N. winogradskyi requires a multifaceted strategy:

  • Homology modeling and structural prediction:

    • Generate 3D structural models of N. winogradskyi MscL based on crystallographic data from homologous channels

    • Validate predictions through site-directed mutagenesis of key residues

    • Use molecular dynamics simulations to predict channel behavior in membranes with compositions mimicking N. winogradskyi

  • Systems biology approaches:

    • Develop genome-scale metabolic models of N. winogradskyi incorporating osmotic stress responses

    • Model the interplay between nitrogen metabolism and osmoregulation

    • Create predictive frameworks for gene regulatory networks connecting quorum sensing with stress responses

  • Integrated workflow example:

    Computational ApproachPredictionExperimental ValidationRefinement Process
    Homology modelingCritical residues for gatingSite-directed mutagenesisUpdate model with experimental data
    Molecular dynamicsMembrane tension thresholdPatch-clamp measurementsAdjust force fields based on results
    Gene regulatory networksExpression patternsRT-qPCR time courseRefine network connections
    Metabolic flux analysisMetabolic shifts during osmotic stressMetabolomics profileIterative model improvement
  • Machine learning integration:

    • Train models on experimental data to predict optimal conditions for MscL expression

    • Use feature extraction to identify patterns in electrophysiological data

    • Develop algorithms to automate analysis of patch-clamp recordings

  • Collaborative model refinement:

    • Implement an iterative cycle where experimental results inform computational model refinement

    • Use computational predictions to guide experimental design, creating a feedback loop

    • Develop shared data repositories to facilitate collaborative model improvement

This integrated approach leverages the strengths of both computational and experimental methodologies, accelerating discovery while providing deeper mechanistic insights into MscL function in the context of N. winogradskyi's specialized physiology and ecology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.