Recombinant Nitrobacter winogradskyi Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
lgt; Nwi_2504; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
lgt
Target Protein Sequence
MFLLITYPVFDPVAISLGPIAIRWYALAYIGGIMLGWLYARALLRSEKLWGGPAPISVVQ LDDFILWVTIAIIVGGRVGYVLFYNPDYFIRYPAQIFQLWNGGMSFHGGFMGCVAAVILF CRRHGLPILSLGDVATAVGPIGLFLGRIANFINSELWGRPADPGLPWAMVFPNGGPLPRH PSQLYEAALEGILLFTILALMIRLGALKRPGLVLGSFIALYAMARIVAEFFREPDPQLGF LWGGLTMGMLLSIPMVIIGLAIVYAAWSRGSRASDAQASPNSGASTKVDRD
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Nitrobacter winogradskyi* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of prolipoprotein diacylglyceryl transferase (Lgt) in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in bacterial lipoprotein biogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox motif of bacterial prelipoproteins. This reaction creates a thioether bond, resulting in a diacylated prolipoprotein intermediate that serves as a substrate for subsequent processing enzymes in the lipoprotein maturation pathway. In Gram-negative bacteria like Nitrobacter winogradskyi, this enzymatic activity is essential for membrane stability and various cellular functions mediated by lipoproteins .

The reaction catalyzed by Lgt produces glycerol phosphate as a byproduct. Due to the racemic nature of the glycerol moiety in phosphatidylglycerol substrates, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be released during the enzymatic reaction, which is an important consideration when designing activity assays for Lgt .

What are the structural characteristics of bacterial Lgt enzymes that would likely apply to N. winogradskyi Lgt?

Bacterial Lgt enzymes, including the putative Lgt from N. winogradskyi, are integral membrane proteins located in the inner membrane (IM) of Gram-negative bacteria. These enzymes contain multiple transmembrane domains that position the active site at the membrane interface to facilitate access to both the phosphatidylglycerol substrate embedded in the membrane and the prolipoprotein substrates that are being translocated across the membrane via Sec or Tat secretion pathways .

The active site of Lgt likely contains a conserved binding pocket for phosphatidylglycerol and recognition elements for the lipobox motif of prolipoproteins. Based on studies of Lgt from other bacteria, the enzyme's activity is dependent on the presence of the conserved cysteine in the lipobox, as demonstrated by the loss of substrate modification when this cysteine is mutated to alanine (as in the Pal-IAA mutant peptide described in the literature) .

What are the optimal conditions for heterologous expression of N. winogradskyi Lgt in E. coli systems?

For recombinant expression of membrane proteins like N. winogradskyi Lgt, several considerations are crucial for successful production. Expression should be conducted in E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3). These strains have mutations that prevent the toxic effects often associated with overexpression of membrane proteins.

The expression vector should contain:

  • A moderate-strength inducible promoter (such as T7lac rather than strong T7)

  • A suitable fusion tag that aids in purification without compromising activity (His6 or Strep-tag II)

  • A TEV or PreScission protease cleavage site for tag removal

Expression conditions typically require:

  • Induction at lower temperatures (16-20°C)

  • Extended expression time (16-24 hours)

  • Lower inducer concentrations (0.1-0.5 mM IPTG)

  • Supplementation with extra phospholipids or membrane-stabilizing agents

The addition of specific phospholipids, particularly phosphatidylglycerol, which serves as a substrate for Lgt, may enhance the stability of the recombinant enzyme during expression and purification .

What purification strategies yield the highest activity retention for N. winogradskyi Lgt?

Purification of membrane proteins like Lgt requires specialized approaches to maintain enzyme activity:

  • Membrane isolation: Cells should be disrupted by gentle methods (such as French press or sonication), followed by differential centrifugation to isolate the membrane fraction.

  • Solubilization: Critical parameters include:

    • Detergent selection (DDM, LMNG, or LDAO are commonly effective)

    • Detergent concentration (typically 1-2% for extraction, reduced to 0.02-0.05% for purification steps)

    • Inclusion of stabilizing lipids (0.01-0.05% phosphatidylglycerol)

    • Buffer composition (pH 7.5-8.0 with 10-20% glycerol)

  • Chromatography sequence:

    • Initial IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Ion exchange chromatography as an intermediate step

    • Size exclusion chromatography as a final polishing step

Throughout purification, it is essential to monitor Lgt activity using biochemical assays that detect the release of glycerol phosphate, such as the coupled luciferase reaction described in the literature for E. coli Lgt .

How can researchers verify the functional integrity of purified recombinant N. winogradskyi Lgt?

Several complementary approaches can verify the functional integrity of purified Lgt:

  • Biochemical activity assay: Measure the transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates by quantifying glycerol phosphate release. A coupled luciferase-based detection system, as described for E. coli Lgt, provides a sensitive readout of enzymatic activity .

  • Substrate binding assays: Assess binding of phosphatidylglycerol and peptide substrates using techniques like:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based binding assays with labeled substrates

  • Lipobox peptide modification assay: Use mass spectrometry to detect the mass shift associated with diacylglyceryl addition to synthetic peptides containing the lipobox sequence.

  • Inhibitor sensitivity profiling: Test the purified enzyme's sensitivity to known Lgt inhibitors such as the macrocycles G2823 and G2824, which have been shown to inhibit E. coli Lgt with IC50 values of 0.93 μM and 0.18 μM, respectively .

How can researchers develop a reliable in vitro assay system to measure N. winogradskyi Lgt activity?

Developing a robust in vitro assay for N. winogradskyi Lgt activity requires careful consideration of several components:

  • Substrate preparation:

    • Phosphatidylglycerol substrate: Use synthetic phosphatidylglycerol or extract it from bacterial membranes. Ensure consistent acyl chain composition, as this affects enzyme kinetics.

    • Peptide substrate: Synthesize peptides containing the lipobox motif [LVI][ASTVI][GAS]C. The peptide used for E. coli Lgt studies, Pal-IAAC, where C is the conserved cysteine that receives modification, can serve as a template .

  • Reaction conditions optimization:

    • Buffer composition: Typically 50 mM HEPES or Tris, pH 7.5-8.0

    • Salt concentration: 100-150 mM NaCl

    • Detergent: 0.01-0.05% DDM or LMNG

    • Additional components: MgCl₂ (5-10 mM), glycerol (10%)

    • Temperature: 25-30°C

    • Time course: Establish linear range (typically 15-60 minutes)

  • Product detection methods:

    • Glycerol phosphate detection: A coupled enzymatic assay that converts released glycerol phosphate to a luminescent or colorimetric signal, as described for E. coli Lgt .

    • Mass spectrometry: Direct detection of the diacylglyceryl modification on peptide substrates.

    • Radioactive assay: Using radiolabeled phosphatidylglycerol to track transfer of the diacylglyceryl moiety.

  • Validation controls:

    • Negative control: Mutant peptide substrate with cysteine substituted by alanine (e.g., Pal-IAA)

    • Enzyme inactivation: Heat-denatured enzyme

    • Inhibitor control: Known Lgt inhibitors at concentrations exceeding their IC50 values

What strategies can researchers use to identify specific inhibitors of N. winogradskyi Lgt?

To identify specific inhibitors of N. winogradskyi Lgt, researchers can employ the following strategies:

  • Structure-based virtual screening:

    • Generate a homology model of N. winogradskyi Lgt based on related bacterial Lgt structures

    • Identify potential binding pockets, focusing on the phosphatidylglycerol binding site

    • Screen virtual compound libraries for molecules predicted to bind these sites

    • Select candidates for experimental validation

  • High-throughput biochemical screening:

    • Adapt the glycerol phosphate release assay to a 384- or 1536-well plate format

    • Screen chemical libraries, focusing on compound classes known to target membrane enzymes

    • Perform dose-response studies on initial hits to determine IC50 values

  • Evaluation of known Lgt inhibitors:

    • Test macrocyclic compounds like G9066, G2823, and G2824, which have been shown to inhibit E. coli Lgt with IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively

    • Assess structure-activity relationships to understand species selectivity

  • Functional validation in cellular systems:

    • Develop genetic tools for modulating Lgt expression in model systems

    • Use CRISPRi technology to decrease gene expression of Lgt and assess whether this sensitizes cells to potential inhibitors, as demonstrated for E. coli Lgt

    • Confirm on-target activity by analyzing lipoprotein processing patterns using Western blot analysis

How can researchers assess the role of N. winogradskyi Lgt in membrane integrity and antibiotic resistance?

To investigate the role of N. winogradskyi Lgt in membrane integrity and antibiotic susceptibility, researchers can:

  • Generate conditional Lgt depletion strains:

    • Construct inducible expression systems where Lgt levels can be modulated

    • Analyze phenotypic changes upon Lgt depletion, focusing on:

      • Membrane permeability using fluorescent dyes (e.g., SYTOX Green, propidium iodide)

      • Electron microscopy to visualize membrane blebbing and morphological changes

      • Susceptibility to serum killing and various antibiotics

  • Evaluate lipoprotein processing and localization:

    • Analyze processing intermediates by Western blot, looking for accumulation of unmodified prolipoproteins (UPLP) upon Lgt depletion or inhibition

    • Fractionate cells to examine lipoprotein distribution between inner and outer membranes

    • Assess the integrity of outer membrane tethering to peptidoglycan by analyzing Lpp (major outer membrane lipoprotein) forms

  • Antibiotic susceptibility testing:

    • Determine minimum inhibitory concentrations (MICs) of various antibiotic classes

    • Assess synergy between Lgt inhibitors and existing antibiotics

    • Compare results with those from other lipoprotein biosynthesis pathway inhibitors

  • Analyze resistance mechanisms:

    • Investigate whether deletion of major outer membrane lipoproteins affects sensitivity to Lgt inhibition, noting that unlike with inhibitors of other steps in the lipoprotein biosynthesis pathway, deletion of lpp does not provide resistance to Lgt inhibitors

    • Explore potential alternative pathways for lipoprotein processing that might compensate for Lgt deficiency

How does N. winogradskyi Lgt compare functionally and structurally to Lgt enzymes from other bacterial species?

While specific data on N. winogradskyi Lgt is limited, comparative analysis with other bacterial Lgt enzymes suggests:

Bacterial SpeciesMolecular Weight (kDa)Substrate SpecificityInhibitor SensitivityMembrane Localization
E. coli~33Requires lipobox [LVI][ASTVI][GAS]CSensitive to macrocycles (G2823, G2824)Inner membrane
A. baumannii~33Similar to E. coliSensitive to Lgt inhibitorsInner membrane
N. winogradskyi (predicted)~30-35Likely recognizes canonical lipoboxPredicted sensitivity to Lgt inhibitorsLikely inner membrane

Structural predictions would suggest similar transmembrane topology and active site architecture, though N. winogradskyi Lgt may exhibit unique surface properties related to its ecological niche and the specific membrane composition of this organism.

What unique adaptations might N. winogradskyi Lgt exhibit relative to Lgt from heterotrophic bacteria?

As a specialized nitrite-oxidizing bacterium, N. winogradskyi likely possesses adaptations in its Lgt enzyme that reflect its unique physiology:

  • Substrate specificity adaptations:

    • Modified lipobox recognition patterns that may be optimized for lipoproteins involved in nitrite oxidation systems

    • Potential accommodation of unique signal peptide variations found in autotrophic bacteria

  • Environmental adaptations:

    • Enhanced stability under the redox conditions associated with nitrification

    • Optimized activity at the temperature and pH ranges typical of nitrifying environments

    • Potential interactions with electron transport chain components specific to nitrite oxidizers

  • Membrane composition considerations:

    • Adaptation to the unique phospholipid composition of nitrite-oxidizing bacteria

    • Specialized interactions with membrane proteins involved in energy generation from nitrite

  • Integration with metabolic pathways:

    • Potential regulatory mechanisms linking lipoprotein processing to nitrogen metabolism

    • Adaptations related to carbon fixation and energy conservation mechanisms unique to N. winogradskyi

Research into these adaptations would provide valuable insights into how essential cellular processes like lipoprotein biosynthesis are fine-tuned in specialized bacterial groups .

What are the most common challenges in expressing recombinant N. winogradskyi Lgt and how can they be addressed?

Researchers often encounter several challenges when working with recombinant N. winogradskyi Lgt:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host; reduce culture temperature to 16-20°C; use specialized expression strains like C41(DE3); explore different fusion tags and their positions.

    • Evaluation: Monitor expression using Western blot with antibodies against the fusion tag or Lgt-specific antibodies.

  • Protein misfolding and aggregation:

    • Solution: Include membrane-mimetic environments during expression (detergents, amphipols); co-express with chaperone proteins; add specific phospholipids to growth media.

    • Evaluation: Analyze protein solubility after membrane extraction with different detergents; assess aggregation state by size exclusion chromatography.

  • Loss of activity during purification:

    • Solution: Minimize purification steps; maintain constant detergent concentration above CMC; include phosphatidylglycerol in all buffers; add stabilizing agents (glycerol, specific ions).

    • Evaluation: Test activity at each purification step using the glycerol phosphate release assay; monitor protein stability by thermal shift assays.

  • Difficulties with activity assays:

    • Solution: Ensure proper substrate preparation; optimize detergent type and concentration for assay conditions; evaluate multiple detection methods.

    • Evaluation: Include positive controls using well-characterized Lgt enzymes from other species; establish signal-to-noise ratios for the assay.

How can researchers definitively distinguish between Lgt-specific effects and off-target effects when using inhibitors or genetic approaches?

To distinguish between Lgt-specific and off-target effects, researchers should implement multiple complementary approaches:

  • Genetic validation strategies:

    • CRISPRi downregulation of lgt gene expression to create a sensitized background for inhibitor testing

    • Complementation studies with wild-type and catalytically inactive Lgt variants

    • Heterologous expression of Lgt variants with altered inhibitor binding but retained catalytic activity

  • Biochemical confirmation:

    • Direct demonstration of inhibitor binding to purified Lgt using biophysical techniques (ITC, SPR)

    • Correlation between inhibition of isolated enzyme activity and cellular effects

    • Competition assays with substrate to determine mechanism of inhibition

  • Molecular markers of Lgt inhibition:

    • Western blot analysis to detect accumulation of unmodified prolipoproteins (UPLP)

    • Analysis of membrane fractions to confirm altered lipoprotein distribution

    • Monitoring of downstream effects on specific outer membrane lipoproteins

  • Comparative analysis with other pathway inhibitors:

    • Side-by-side testing with inhibitors of other steps in lipoprotein biosynthesis (LspA, Lnt, LolCDE)

    • Analysis of cross-resistance or cross-sensitization patterns

    • Genetic epistasis experiments combining inhibitors with mutations in lipoprotein processing pathway components

These approaches, particularly when used in combination, can provide strong evidence for the specificity of observed effects to Lgt inhibition rather than off-target activities.

What methodological approaches are most effective for studying the impact of N. winogradskyi Lgt on bacterial physiology and nitrite oxidation?

To comprehensively investigate the role of N. winogradskyi Lgt in bacterial physiology and nitrite oxidation, researchers should consider these methodological approaches:

  • Conditional gene expression systems:

    • Develop inducible or repressible Lgt expression systems in N. winogradskyi

    • Create partial depletion conditions to identify primary effects before cell death

    • Analyze growth, morphology, and nitrite oxidation capabilities under Lgt depletion

  • Physiological measurements:

    • Monitor nitrite oxidation rates using ion chromatography or colorimetric assays

    • Measure respiratory activity with oxygen electrodes or fluorescent probes

    • Analyze membrane potential and proton motive force using fluorescent indicators

  • Lipidomics and proteomics analysis:

    • Compare lipoprotein profiles in wild-type and Lgt-depleted conditions

    • Identify lipoproteins associated with nitrite oxidation using mass spectrometry

    • Analyze membrane lipid composition changes in response to Lgt depletion

  • Structural biology approaches:

    • Electron microscopy to visualize membrane architecture changes

    • Localization studies of key lipoproteins involved in nitrite oxidation

    • Analysis of protein-protein interactions between Lgt and components of the nitrite oxidation system

  • Integration with the nitrite oxidation system:

    • Evaluate the impact of Lgt depletion on cytochrome components (a1c1, c-550, aa3-type cytochrome c oxidase) involved in nitrite oxidation

    • Investigate potential connections between lipoprotein maturation and assembly of the nitrite oxidizing enzyme complex

    • Assess whether lipoproteins play structural or functional roles in maintaining the integrity of the nitrite oxidation machinery

What emerging technologies could advance our understanding of N. winogradskyi Lgt structure and function?

Several cutting-edge technologies hold promise for deeper understanding of N. winogradskyi Lgt:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and substrate binding sites

  • Single-molecule enzymology:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

    • Single-molecule force spectroscopy to investigate protein-membrane interactions

    • Nanodiscs and lipid bilayer systems to study Lgt in near-native membrane environments

  • Genome editing technologies:

    • CRISPR-Cas9 systems adapted for N. winogradskyi to enable precise genetic manipulation

    • Site-specific incorporation of unnatural amino acids to probe catalytic mechanism

    • Targeted protein degradation approaches for rapid depletion of Lgt in vivo

  • Advanced imaging:

    • Super-resolution microscopy to visualize Lgt localization and dynamics in bacterial membranes

    • Correlative light and electron microscopy to connect molecular events with ultrastructural changes

    • Live-cell imaging with fluorescent lipoprotein substrates to track processing in real-time

These technologies, particularly when applied in combination, could provide unprecedented insights into the molecular mechanisms of Lgt function in the context of N. winogradskyi's specialized physiology .

How might understanding N. winogradskyi Lgt contribute to broader questions in bacterial evolution and adaptation?

Research on N. winogradskyi Lgt has the potential to address fundamental questions in bacterial evolution:

  • Evolution of specialized metabolic pathways:

    • How lipoprotein processing systems co-evolved with specialized metabolic capabilities like nitrite oxidation

    • Whether lipoproteins play unique roles in chemolithoautotrophic bacteria compared to heterotrophs

    • How essential cellular processes are maintained while allowing for metabolic specialization

  • Adaptation to ecological niches:

    • How membrane architecture and lipoprotein composition reflect adaptation to specific environmental conditions

    • Whether lipoprotein modifications contribute to survival in nutrient-limited environments

    • The role of horizontal gene transfer in shaping lipoprotein biosynthesis pathways across bacterial lineages

  • Conserved vs. specialized features:

    • Identification of core Lgt features conserved across diverse bacterial phyla

    • Characterization of specialized adaptations in Lgt from metabolically unique organisms

    • Understanding how essential functions like Lgt are maintained while allowing for evolutionary innovation

  • Implications for bacterial pathogenesis:

    • Insights into how Lgt inhibitors might be developed as broad-spectrum antibiotics

    • Understanding resistance mechanisms and their evolution

    • Exploration of lipoprotein processing as a target for controlling bacterial communities in environmental and clinical settings

Through comparative analysis with Lgt from diverse bacterial species, the study of N. winogradskyi Lgt can provide a window into how fundamental cellular processes adapt to support specialized metabolic lifestyles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.