Recombinant Nitrobacter winogradskyi Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Undecaprenyl-diphosphatase (uppP) is a phosphatase enzyme involved in the recycling of undecaprenyl pyrophosphate (UPP), a lipid carrier critical for bacterial cell wall biosynthesis. In Gram-negative bacteria, UPP is essential for glycerophospholipid and peptidoglycan synthesis. The recombinant form of uppP is expressed in E. coli and fused with an N-terminal His tag for purification .

Reconstitution and Handling Guidelines

Reconstitution protocols emphasize:

  • Rehydration: Use deionized sterile water to achieve 0.1–1.0 mg/mL concentration.

  • Stabilization: Add 5–50% glycerol (final concentration) for long-term storage.

  • Avoid: Repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Research Gaps and Species-Specific Considerations

While commercial data describe A. brasilense uppP, no peer-reviewed studies explicitly characterize Nitrobacter winogradskyi uppP. Key gaps include:

  • Functional Validation: No experimental evidence links N. winogradskyi uppP to lipid metabolism or stress responses.

  • Genomic Context: N. winogradskyi’s genome lacks direct references to uppP in available annotations .

Applications in Research

Though not directly studied in N. winogradskyi, uppP’s role in bacterial physiology suggests potential applications:

  • Antibiotic Resistance: In Bacillus subtilis, uppP homologs confer bacitracin resistance by recycling UPP .

  • Biofilm Formation: UPP metabolism may influence membrane integrity and biofilm architecture.

Recombinant Nitrobacter winogradskyi uppP remains poorly characterized in scientific literature. Current data derive from A. brasilense homologs, highlighting the need for targeted studies to validate its role in N. winogradskyi. Future research should prioritize functional assays, gene knockout experiments, and comparative genomic analysis to elucidate its physiological significance.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
uppP; Nwi_0165; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Target Names
uppP
Target Protein Sequence
MISDAIRAVILGIIEGVTEFLPVSSTGHLLLAERFFDLGSGNFWDTFTVLIQPGAILAIV VIYFAKLWRVALGMFSNPADRRFVIGVLAAFLPAVIVGLIAGKYIKELLFNPWVVCFSLI VGGAVLMWVDQLDHRPREHDATAFPLPMYVWIGIAQCVAMIPGVSRSGATIVSAMLLGAD KRAAAEFSFFLAIPTMTGAFAYDFYKNHADMTTDDLGTVAIGFVVSFVTAIIVVKAFLSY VTRNGFTFFAWWRVIVGTLGLIALALGR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Undecaprenyl-diphosphatase (uppP) in Nitrobacter winogradskyi?

Undecaprenyl-diphosphatase (uppP) in Nitrobacter winogradskyi catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate. This reaction is crucial for bacterial cell wall synthesis as undecaprenyl phosphate serves as an essential carrier lipid in this process. The enzyme is classified as an integral membrane protein with multiple transmembrane domains that facilitate its function within the cell membrane environment. The dephosphorylation process is a critical step in both the de novo synthesis pathway and the recycling pathway of undecaprenyl phosphate, which is necessary for bacterial cell wall biosynthesis and maintenance .

What is the subcellular localization of uppP in bacterial cells?

UppP is primarily localized in the cell inner membrane as a multi-pass membrane protein. The protein traverses the membrane multiple times with its active site oriented toward the periplasmic space. This orientation is significant because it indicates that the enzyme performs its catalytic function on the outer side of the plasma membrane rather than in the cytoplasm. This localization contrasts with earlier assumptions about UppP functioning primarily in the cytoplasmic space. Topology studies reveal that both consensus regions containing the catalytic motifs (E/Q)XXXE and PGXSRSXXT, along with a histidine residue, are positioned near the aqueous interface of the membrane and oriented toward the periplasmic site .

What is the relationship between quorum sensing and uppP activity in Nitrobacter winogradskyi?

While direct evidence linking quorum sensing (QS) specifically to uppP activity in Nitrobacter winogradskyi is limited, research on N. winogradskyi has demonstrated that quorum sensing plays a significant role in regulating genes involved in nitrogen metabolism. Through quorum quenching approaches (addition of recombinant AiiA lactonase to degrade acyl-homoserine lactones and prevent QS), researchers have observed changes in expression patterns of genes related to nitrogen oxide metabolism .

How does the kinetic profile of Nitrobacter winogradskyi uppP differ from other bacterial phosphatases?

E. coli UppP has been found to generate approximately 75% of the total cellular C55-PP phosphatase activity, while additional enzymes (PgpB, YbjG, and LpxT) account for the remaining 25%. It would be valuable to determine if N. winogradskyi follows a similar distribution of phosphatase activities or if it has evolved different enzymatic efficiency. Additionally, while E. coli possesses multiple genes encoding proteins with C55-PP phosphatase activity, the complement of such enzymes in N. winogradskyi might differ, potentially leading to different kinetic profiles and regulation mechanisms .

What are the optimal conditions for expressing and purifying recombinant Nitrobacter winogradskyi uppP?

The expression and purification of recombinant Nitrobacter winogradskyi uppP can be achieved using an E. coli expression system, similar to the methods developed for E. coli UppP. The following protocol represents an optimized approach based on available literature:

  • Expression System Selection: Use E. coli C41(DE3) strain, which is designed for expression of toxic and membrane proteins.

  • Vector Construction: Design a construct with an N-terminal histidine tag (10xHis is recommended) to facilitate purification. Consider using a bacteriorhodopsin fusion tag to improve expression and folding.

  • Culture Conditions:

    • Growth medium: LB medium with appropriate antibiotic selection

    • Temperature: 37°C until OD600 reaches 0.9

    • Induction: 0.5 mM IPTG

    • Post-induction incubation: 5 hours at 37°C

  • Membrane Extraction:

    • Cell disruption using mechanical methods (e.g., Constant Cell Disruption Systems)

    • Membrane collection by ultracentrifugation (40,000 rpm for 1.5 hours)

  • Protein Solubilization:

    • Solubilize membrane pellet in buffer containing 50 mM Tris pH 7.5, 500 mM NaCl

    • Add 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM) as detergent

    • Incubate at 4°C for 2.5 hours

  • Purification Steps:

    • Nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography

    • Wash with buffer containing 75 mM imidazole and 0.05% DDM

    • Tag removal using Tobacco Etch Virus (TEV) protease during dialysis

    • Second Ni-NTA column to separate native protein

    • Final elution in buffer containing 0.02% DDM

  • Storage:

    • Flash-freeze aliquots in liquid nitrogen

    • Store at -80°C for long-term stability

This protocol has been shown to yield active protein suitable for enzymatic and structural studies. The inclusion of appropriate detergents is crucial for maintaining the native structure and activity of this integral membrane protein.

What assays are most effective for measuring Nitrobacter winogradskyi uppP activity?

Several assays can effectively measure the phosphatase activity of Nitrobacter winogradskyi uppP:

  • Phosphate Colorimetric Assay:

    • Reaction mixture (200 μL): 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl₂, 0.02% DDM, substrate (e.g., 35 mM Fpp), and purified uppP (20 nM)

    • Incubation at 37°C

    • Reaction quenching with Malachite Green reagent

    • Colorimetric detection of released phosphate at 650 nm

    • Quantification using a phosphate standard curve

  • pH-Dependent Activity Profiling:

    • Conduct the phosphatase assay across a range of pH values:

      • pH 5-6 using sodium acetate buffer

      • pH 6.5-8 using Hepes buffer

      • pH 9 using Tris-HCl buffer

    • This approach helps determine the optimal pH for enzyme activity and provides insights into the catalytic mechanism

  • Kinetic Parameter Determination:

    • Vary substrate concentrations (e.g., 0.3-57 μM Fpp)

    • Use 20-40 nM purified enzyme

    • Standard reaction conditions: 50 mM Hepes (pH 7.0), 150 mM NaCl, 10 mM MgCl₂, 0.02% DDM at 37°C

    • Fit initial velocity data to the Michaelis-Menten equation to determine Km and kcat values

  • Radiolabeled Substrate Assay:

    • Use ³²P-labeled undecaprenyl pyrophosphate as substrate

    • Separate reaction products by thin-layer chromatography

    • Quantify radiolabeled products using phosphorimaging

    • This method offers higher sensitivity for detailed kinetic studies

These assays can be adapted based on specific research questions and available equipment. The phosphate colorimetric assay offers simplicity and reliability for routine activity measurements, while the radiolabeled substrate approach provides greater sensitivity for detailed mechanistic studies.

How can site-directed mutagenesis be applied to study the catalytic mechanism of uppP?

Site-directed mutagenesis is a powerful approach for investigating the catalytic mechanism of Nitrobacter winogradskyi uppP. Based on sequence alignments and structural predictions, several key residues can be targeted for mutagenesis:

  • Target Residue Selection:

    • Focus on conserved motifs: (E/Q)XXXE and PGXSRSXXT

    • Target the conserved histidine residue believed to be involved in the catalytic mechanism

    • Consider acidic residues (Glu, Asp) that might coordinate metal ions or participate in nucleophilic attack

    • Examine positively charged residues (Arg, Lys) that could stabilize the negatively charged phosphate groups

  • Mutagenesis Strategy:

    • Conservative substitutions: Replace with amino acids of similar properties to assess subtle functional effects (e.g., Glu→Asp, Ser→Thr)

    • Non-conservative substitutions: Replace with amino acids of different properties to dramatically alter function (e.g., Glu→Ala, His→Ala)

    • Charge reversal: Replace charged residues with oppositely charged ones to test electrostatic interactions (e.g., Asp→Lys)

  • Functional Analysis of Mutants:

    • Express and purify each mutant using the same protocol as for wild-type

    • Measure enzymatic activity using the phosphate colorimetric assay

    • Determine kinetic parameters (Km, kcat, kcat/Km) for each mutant

    • Analyze pH-activity profiles to identify shifts in optimal pH

    • Test metal ion dependence to identify residues involved in metal coordination

  • Structural Analysis:

    • Assess protein folding and stability using circular dichroism spectroscopy

    • Perform thermal stability assays to identify destabilizing mutations

    • If possible, obtain crystal structures of key mutants to visualize structural changes

  • Data Interpretation Framework:

    MutationExpected Effect if Involved in CatalysisExpected Effect if Involved in Substrate Binding
    E→A in (E/Q)XXXE motifSignificant reduction in kcatModerate increase in Km
    S→A in PGXSRSXXT motifModerate reduction in kcatVariable effect on Km
    H→A (conserved His)Significant reduction in kcatMinimal effect on Km
    R→A in PGXSRSXXT motifModerate effect on kcatSignificant increase in Km
  • Combined Mutations:

    • Generate double or triple mutants to test cooperativity between residues

    • Look for synergistic or compensatory effects that reveal functional relationships

This systematic mutagenesis approach can provide detailed insights into the catalytic mechanism of uppP, identifying residues involved in substrate binding, catalysis, and structural integrity of the enzyme active site.

How do the transmembrane domains of uppP contribute to its catalytic function?

The transmembrane domains of uppP play crucial roles in both structural stabilization and functional activity of the enzyme. Based on protein structure predictions and functional studies of related enzymes, we can infer the following contributions:

  • Substrate Channel Formation: The transmembrane helices likely arrange to form a hydrophobic channel or cavity that facilitates the binding of the undecaprenyl pyrophosphate substrate. This arrangement allows the lipid portion of the substrate to remain embedded in the membrane while positioning the pyrophosphate group at the active site.

  • Active Site Positioning: The transmembrane domains position the catalytic residues within the (E/Q)XXXE and PGXSRSXXT motifs at the periplasmic membrane interface where they can access the pyrophosphate group of the substrate while the hydrophobic undecaprenyl chain remains in the membrane environment.

  • Conformational Flexibility: The transmembrane domains likely provide the necessary conformational flexibility for the enzyme to bind substrate, catalyze the reaction, and release products. This flexibility may involve subtle movements of helices to accommodate the substrate and facilitate product release.

  • Lipid Interaction: The first transmembrane helix contains a consensus motif specific to UppP enzymes that is suggested to be involved in lipid substrate binding. This specialized interface may recognize the unique structure of the undecaprenyl chain.

  • Periplasmic Orientation: The orientation of the transmembrane domains ensures that the active site is positioned toward the periplasmic space, suggesting that the dephosphorylation of undecaprenyl pyrophosphate occurs on the outer side of the plasma membrane rather than in the cytoplasm as previously thought .

Understanding these structure-function relationships is essential for designing inhibitors or modifying the enzyme for biotechnological applications. The complex membrane integration of uppP also explains the challenges in producing sufficient quantities of properly folded and active protein for structural studies.

What are the key differences between uppP and other phosphatases involved in bacterial cell wall synthesis?

UppP exhibits several distinctive features compared to other phosphatases involved in bacterial cell wall synthesis:

  • Sequence Homology and Evolutionary Origin:

    • UppP has no sequence homology with other C55-PP phosphatases like PgpB, YbjG, and LpxT

    • While PgpB, YbjG, and LpxT belong to the phosphatidic acid phosphatase type 2 superfamily characterized by three conserved motifs (KX6RPX12–54PSGHX31–54SRX5HX3D), uppP lacks these motifs and represents a distinct protein family

    • This suggests different evolutionary origins despite convergent functions

  • Structural Organization:

    • UppP contains approximately eight transmembrane helices

    • PgpB, YbjG, and LpxT possess different membrane topology with fewer transmembrane spans

    • UppP's active site is defined by (E/Q)XXXE and PGXSRSXXT motifs, unlike the motifs in the phosphatidic acid phosphatase family

  • Substrate Specificity:

    • While all these enzymes can dephosphorylate undecaprenyl pyrophosphate, they differ in their substrate preferences

    • For example, PgpB has broader substrate specificity and can also dephosphorylate phosphatidylglycerol phosphate and phosphatidic acid

    • LpxT can transfer phosphate from C55-PP to lipid A, a function not observed in UppP

  • Cellular Function:

    • UppP generates approximately 75% of total cellular C55-PP phosphatase activity in E. coli

    • The other enzymes (PgpB, YbjG, and LpxT) collectively account for the remaining 25%

    • While UppP was thought to participate primarily in the de novo synthesis pathway, evidence now suggests it may also function in the recycling pathway at the periplasmic site

  • Inhibition Profiles:

    • UppP and the other phosphatases show different sensitivities to inhibitors

    • This differential inhibition provides opportunities for selective targeting in antimicrobial development

These differences highlight the complexity of bacterial cell wall synthesis regulation and suggest that bacteria have evolved multiple enzymatic systems to ensure robust cell wall maintenance under various environmental conditions.

What role does the conserved histidine residue play in the catalytic mechanism of uppP?

The conserved histidine residue in uppP plays a critical role in the catalytic mechanism of the enzyme based on structural predictions and functional studies:

  • Proton Transfer: The histidine likely functions as a general acid-base catalyst in the dephosphorylation reaction. Its imidazole side chain can both donate and accept protons at physiological pH, making it ideal for this role. During catalysis, it may protonate the leaving group (phosphate) to facilitate its departure.

  • Nucleophile Activation: The histidine may activate a water molecule by abstracting a proton, generating a hydroxide ion that serves as the nucleophile to attack the phosphorus atom of the pyrophosphate group.

  • Substrate Positioning: In addition to its catalytic role, the histidine may help position the substrate correctly within the active site through hydrogen bonding or electrostatic interactions with the phosphate groups.

  • Metal Coordination: In some phosphatases, histidine residues participate in coordinating metal ions (typically Mg²⁺) that are essential for catalysis. The metal ion can stabilize the negative charges on the phosphate groups and assist in positioning the substrate.

  • pH Dependence: The catalytic activity of uppP shows pH dependence that aligns with the typical pKa of histidine residues (approximately 6-7), supporting its role in the catalytic mechanism. This is consistent with the observation that UppP activity is commonly assayed across a pH range of 5-9, with optimal activity typically observed at pH 7-8.

Mutagenesis studies in E. coli UppP have shown that substitution of the conserved histidine with alanine significantly reduces enzymatic activity, confirming its essential role in catalysis. This histidine works in concert with the conserved glutamate residues in the (E/Q)XXXE motif and the serine and arginine residues in the PGXSRSXXT motif to create a coordinated catalytic center .

The exact position of this histidine relative to other catalytic residues would ideally be confirmed through crystallographic studies, which have been challenging due to the membrane-embedded nature of the enzyme.

How conserved is uppP across different bacterial species, and what does this suggest about its evolutionary importance?

UppP shows remarkable conservation across diverse bacterial species, indicating its fundamental importance in bacterial physiology. Analysis of sequence conservation patterns reveals:

This high degree of conservation makes uppP an attractive target for broad-spectrum antimicrobial development, as compounds targeting the conserved regions might be effective against diverse bacterial pathogens while potentially sparing eukaryotic cells that lack this enzyme.

How does Nitrobacter winogradskyi uppP activity correlate with its role in the nitrogen cycle?

The correlation between Nitrobacter winogradskyi uppP activity and its role in the nitrogen cycle involves several interconnected aspects:

  • Cell Wall Integrity and Nitrification:

    • As a nitrite-oxidizing bacterium, N. winogradskyi plays a crucial role in the second step of nitrification, converting nitrite to nitrate

    • UppP's function in cell wall synthesis ensures proper membrane integrity, which is essential for maintaining the cellular machinery responsible for nitrite oxidation

    • The cell envelope must maintain optimal permeability to allow nitrite uptake while protecting sensitive cytoplasmic components

  • Energy Metabolism Connection:

    • Nitrite oxidation is an energy-yielding process that drives ATP synthesis in N. winogradskyi

    • This energy is required for various cellular processes, including cell wall synthesis

    • The phosphatase activity of uppP, by recycling undecaprenyl carriers, supports continuous peptidoglycan synthesis without excessive energy expenditure

  • Adaptation to Environmental Conditions:

    • Nitrifying bacteria like N. winogradskyi often face challenging environmental conditions including pH fluctuations

    • Cell wall integrity, maintained through proper uppP function, is critical for stress tolerance

    • Regulation of uppP activity may be part of the adaptive response to environmental changes commonly encountered in nitrogen-cycling environments

  • Quorum Sensing and Nitrogen Metabolism:

    • Studies on N. winogradskyi have shown that quorum sensing influences nitrogen oxide metabolism

    • While direct evidence linking quorum sensing to uppP regulation is limited, it's plausible that population density signals coordinate cell wall maintenance with metabolic shifts

    • Under quorum sensing-proficient conditions, N. winogradskyi shows altered production and consumption of nitrogen oxide gases (NO, NO₂, and N₂O), which requires coordinated regulation of membrane proteins

  • Biofilm Formation:

    • N. winogradskyi can form biofilms in natural and engineered systems (such as wastewater treatment plants)

    • Cell wall synthesis and modification, dependent on uppP activity, are critical for biofilm matrix formation

    • Proper biofilm structure enhances nitrification efficiency in environmental systems

While direct experimental evidence specifically linking uppP activity to nitrogen cycling is limited, the fundamental role of uppP in maintaining cell envelope integrity indirectly supports N. winogradskyi's nitrification function. Future research could explore how environmental factors relevant to the nitrogen cycle affect uppP expression and activity in this specialized bacterium.

Can structural insights from E. coli uppP be applied to predict inhibitor binding sites in Nitrobacter winogradskyi uppP?

Structural insights from E. coli uppP can indeed be applied to predict inhibitor binding sites in Nitrobacter winogradskyi uppP, though with some important considerations:

  • Conserved Active Site Architecture:

    • The key catalytic motifs ((E/Q)XXXE and PGXSRSXXT) and the conserved histidine are present in both species

    • This conservation suggests that inhibitors targeting these regions in E. coli uppP would likely interact similarly with N. winogradskyi uppP

    • Computational modeling approaches like homology modeling can leverage E. coli structural data to predict the N. winogradskyi uppP structure

  • Structural Modeling Approach:

    • Rosetta membrane ab initio modeling, which has been used for E. coli UppP, can be applied to N. winogradskyi uppP

    • This approach incorporates membrane protein-specific energy terms and can predict the position of transmembrane helices and the orientation of key residues

    • Molecular dynamics simulations can refine these models to account for lipid-protein interactions specific to N. winogradskyi

  • Inhibitor Binding Prediction:

    • Docking studies using inhibitors known to target E. coli uppP can identify potential binding sites in N. winogradskyi uppP

    • Virtual screening campaigns can then be conducted to identify compounds with predicted high affinity for N. winogradskyi uppP

    • Fragment-based approaches may identify compounds that interact with specific sub-sites within the active site

  • Sequence Variation Considerations:

    • Despite conservation of key motifs, sequence variations outside these regions may affect inhibitor binding

    • The table below compares potential inhibitor binding regions:

    RegionConservation LevelImpact on Inhibitor BindingApproach to Address Variations
    Active site coreHighMinimal impact - similar binding expectedDirect application of E. coli insights
    Entrance channelModerateMay affect inhibitor accessMD simulations to model channel dynamics
    Peripheral binding pocketsLowCould create species-specific binding opportunitiesTargeted docking to identify unique interactions
    Membrane-embedded regionsModerateAffects lipophilic inhibitor interactionsLipid-protein-ligand simulations
  • Experimental Validation Strategy:

    • Recombinant expression of both E. coli and N. winogradskyi uppP

    • Comparative inhibition studies with candidate compounds

    • Structure-activity relationship analysis to identify features conferring selectivity

    • Mutagenesis of non-conserved residues near the active site to assess their role in inhibitor binding

While using E. coli uppP as a template provides a valuable starting point, the ultimate validation of inhibitor binding predictions requires experimental testing with purified N. winogradskyi uppP. The differences in the microenvironments of these enzymes (different membrane compositions, associated proteins, etc.) may influence inhibitor binding in ways not captured by sequence comparison alone.

How can recombinant Nitrobacter winogradskyi uppP be used as a tool to study bacterial cell wall synthesis?

Recombinant Nitrobacter winogradskyi uppP serves as a valuable research tool for investigating bacterial cell wall synthesis through several applications:

  • In vitro Reconstitution Systems:

    • Purified recombinant uppP can be incorporated into liposomes or nanodiscs to create minimal systems for studying undecaprenyl phosphate cycling

    • These reconstituted systems allow precise control over reaction components to dissect the sequential steps of cell wall precursor synthesis

    • By combining uppP with other enzymes involved in peptidoglycan synthesis, researchers can reconstruct and study the complete pathway under defined conditions

  • Inhibitor Screening Platform:

    • The recombinant enzyme provides a platform for high-throughput screening of potential inhibitors

    • Compounds identified can serve as chemical probes to study bacterial cell wall synthesis in vivo

    • Structure-activity relationship studies using uppP can guide rational design of antibacterial agents targeting cell wall synthesis

  • Comparative Enzymology:

    • Side-by-side analysis of uppP from different bacterial species (e.g., N. winogradskyi vs. E. coli) can reveal species-specific adaptations in cell wall synthesis

    • Chimeric enzymes, created by swapping domains between uppP from different species, can identify regions responsible for specific functional properties

    • These comparisons provide evolutionary insights into how different bacteria have optimized this essential process

  • Biophysical Characterization:

    • Recombinant uppP enables detailed biophysical studies including:

      • Thermodynamic analysis of substrate binding

      • Conformational changes during catalysis measured by fluorescence spectroscopy

      • Protein-lipid interactions assessed by surface plasmon resonance

    • These studies help elucidate how membrane proteins function within the complex lipid bilayer environment

  • Synthetic Biology Applications:

    • Engineered variants of uppP with altered substrate specificity or increased activity can be used to enhance production of glycopeptides or other bacterial cell wall-derived compounds

    • Incorporation of uppP into synthetic pathways could enable production of modified cell wall components with novel properties

    • Expression of N. winogradskyi uppP in heterologous hosts might confer resistance to certain antibiotics, providing a tool to study antibiotic mechanisms

By providing access to a purified, functionally active form of this essential enzyme, recombinant N. winogradskyi uppP enables detailed mechanistic studies that would be difficult or impossible to conduct in whole-cell systems.

What insights can uppP studies provide about bacterial resistance to cell wall-targeting antibiotics?

Studies of uppP provide significant insights into bacterial resistance to cell wall-targeting antibiotics through several mechanisms:

  • Bacitracin Resistance Mechanism:

    • UppP is also known as bacitracin resistance protein in some species

    • Bacitracin acts by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and recycling

    • Increased expression or activity of uppP can overcome this inhibition by rapidly dephosphorylating undecaprenyl pyrophosphate before bacitracin can bind

    • Understanding the structure-function relationship of uppP provides insights into how bacteria evade this antibiotic mechanism

  • Cell Wall Synthesis Pathway Redundancy:

    • In E. coli, four enzymes (UppP, PgpB, YbjG, and LpxT) have C55-PP phosphatase activity

    • This redundancy ensures that inhibition of a single enzyme may not completely block cell wall synthesis

    • Studies suggest that UppP generates approximately 75% of total cellular phosphatase activity, with the other enzymes contributing the remaining 25%

    • This distribution varies across bacterial species, potentially explaining differences in antibiotic susceptibility

  • Adaptation Mechanisms:

    • Bacteria can upregulate uppP expression in response to cell wall stress

    • Mutations in uppP can alter its activity or inhibitor binding without compromising its essential function

    • Point mutations affecting the active site architecture might preserve catalytic function while reducing antibiotic binding affinity

    • Understanding these adaptations helps predict resistance development patterns

  • Synergistic Antibiotic Effects:

    • Inhibition of uppP can potentially sensitize bacteria to other cell wall-targeting antibiotics

    • The relationship between uppP inhibition and efficacy of β-lactams, glycopeptides, and other cell wall synthesis inhibitors provides insights for combination therapy approaches

    • This knowledge informs strategies to overcome existing resistance mechanisms

  • Comparative Analysis Table of Resistance Mechanisms:

    Resistance MechanismMolecular BasisDetection MethodClinical Significance
    UppP overexpressionGene amplification or promoter mutationsqPCR, RNA-seqReduced efficacy of bacitracin and potentially other cell wall antibiotics
    UppP structural mutationsAmino acid substitutions in or near active siteSequence analysis, enzyme assaysMay confer resistance while maintaining essential function
    Pathway compensationUpregulation of alternative phosphatasesTranscriptomics, proteomicsCreates redundancy that reduces effectiveness of targeted inhibition
    Altered membrane compositionChanges in lipid environment affecting uppP activityLipidomics analysisMay modify drug access to target or enzyme kinetics
  • Species-Specific Resistance Profiles:

    • Different bacterial species show varying resistance patterns based on their complement of undecaprenyl pyrophosphate phosphatases

    • N. winogradskyi uppP may have unique properties that influence its susceptibility to inhibitors compared to other bacterial species

These insights contribute to our understanding of bacterial resistance mechanisms and inform strategies for developing new antibiotics or enhancing the efficacy of existing ones through combination approaches targeting different steps in cell wall synthesis.

How might understanding uppP function contribute to developing new antimicrobial strategies?

Understanding uppP function provides several promising avenues for developing novel antimicrobial strategies:

  • Direct Inhibitor Development:

    • The conserved nature of uppP across bacterial species makes it an attractive broad-spectrum target

    • Knowledge of the enzyme's catalytic mechanism enables rational design of transition-state analogs that bind with high affinity

    • Understanding the unique active site architecture allows design of inhibitors that specifically target bacterial uppP without affecting human enzymes

    • Potential inhibitor classes include:

      • Pyrophosphate mimetics that compete with the natural substrate

      • Covalent inhibitors targeting the conserved active site residues

      • Allosteric inhibitors that disrupt conformational changes necessary for catalysis

  • Combination Therapy Approaches:

    • Inhibiting uppP in conjunction with other cell wall synthesis steps can create synergistic effects

    • UppP inhibitors could potentiate the activity of existing antibiotics like bacitracin by blocking the resistance mechanism

    • This strategy may allow revival of older antibiotics that have lost efficacy due to resistance

    • Potential combinations include:

      • UppP inhibitors + β-lactams (targeting different steps in peptidoglycan synthesis)

      • UppP inhibitors + membrane-disrupting antimicrobials (creating multiple membrane integrity challenges)

      • UppP inhibitors + efflux pump inhibitors (preventing extrusion of compounds)

  • Species-Selective Targeting:

    • Despite conservation of key motifs, sequence differences between uppP from different bacterial species can be exploited

    • Comparative analysis of uppP structures from pathogens versus commensal bacteria may enable selective targeting

    • This approach could reduce disruption of beneficial microbiota during antimicrobial therapy

    • Species-specific pockets adjacent to the active site might be exploited for selective binding

  • Alternative Therapeutic Strategies:

    • Instead of inhibiting uppP activity, modulating its expression or regulation might be effective

    • Small RNAs or CRISPR interference targeting uppP gene expression

    • Compounds that trigger uppP protein degradation (PROTACs approach adapted for bacterial targets)

    • Immunological approaches targeting surface-exposed regions of uppP

  • Biofilm Prevention:

    • Cell wall synthesis is critical for biofilm formation and maintenance

    • Sub-inhibitory concentrations of uppP inhibitors might disrupt biofilm development without selecting strongly for resistance

    • This approach could be particularly valuable for preventing colonization of medical devices

  • Diagnostic Applications:

    • Detection of specific uppP variants or expression levels could identify resistant strains

    • This information could guide antimicrobial selection in clinical settings

    • Rapid tests for uppP-mediated resistance mechanisms could improve treatment outcomes

The essential nature of uppP in bacterial physiology, combined with its absence in humans, makes it a particularly attractive antimicrobial target. As antibiotic resistance continues to spread, targeting fundamental processes like cell wall synthesis through novel mechanisms offers hope for developing effective new treatments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.