Recombinant Nitrogen regulation protein ntrY homolog

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The NtrY homolog refers to a histidine kinase component of the NtrY/NtrX two-component system (TCS), a conserved regulatory pathway in diverse bacteria. This system primarily modulates nitrogen metabolism, redox balance, and symbiotic interactions. Recombinant NtrY homologs are engineered versions of the protein, often used to study its function in controlled experimental settings.

2.1. Core Features of NtrY

  • Domain Architecture: NtrY contains a PAS domain (Per-ARNT-Sim) that senses environmental signals, such as redox changes or nitrogen availability, and a histidine kinase domain that phosphorylates its cognate response regulator (NtrX) .

  • Phosphorylation Mechanism: NtrY autophosphorylates on a conserved histidine residue, transferring the phosphate to NtrX’s aspartate residue (e.g., D53 in Sinorhizobium meliloti) to activate transcriptional control .

2.2. Key Functions

FunctionOrganismMechanismReference
Nitrate uptake regulationAzospirillum brasilienseModulates nitrate transport genes via NtrX-mediated transcriptional control
Symbiotic nodulationAzorhizobium caulinodansRegulates nitrogen fixation genes and host plant interaction
Redox homeostasisRhodobacter capsulatusCoordinates nitrogen metabolism with cellular redox balance
Cell cycle regulationSinorhizobium melilotiDirectly binds promoters of ctrA, gcrA, dnaA, and ftsZ1 to regulate cell division

3.1. Promoter Recognition

NtrY/NtrX systems recognize CAAN₂₋₅TTG motifs in promoter regions. Phosphorylated NtrX binds these sequences to activate or repress target genes. For example:

  • Activation: dnaA (DNA replication) and ftsZ1 (cell division) in S. meliloti .

  • Repression: ctrA and gcrA (cell cycle inhibitors) in S. meliloti .

3.2. Cross-System Interactions

  • NtrY-NtrX Complex: NtrY phosphorylates NtrX, which then binds DNA to regulate gene expression. Mutations in NtrX (e.g., D53E) disrupt this interaction, impairing DNA binding and function .

  • Redox Sensing: In Brucella abortus, NtrY’s PAS domain binds heme, linking nitrogen metabolism to oxygen levels .

4.1. Genetic and Biochemical Studies

StudyKey FindingsMethodologyReference
S. meliloti ntrX mutantsDelayed DNA synthesis, abnormal cell morphology, and altered amino acid poolsGene knockout, qRT-PCR
R. capsulatus NtrY/NtrX analysisDual regulation of nitrogen metabolism and redox balanceGel shift assays
Pseudomonas stutzeri NtrC studiesNtrC regulates nitrogenase protection against oxidative stressRNA-seq, proteomics

4.2. Recombinant NtrY Applications

  • Biotechnology: Engineering NtrY homologs to optimize nitrogen assimilation in biofertilizers or industrial microbes.

  • Agriculture: Modulating symbiotic nitrogen fixation in legume-rhizobia systems for sustainable crop production .

Evolutionary Divergence and Conservation

NtrY homologs are widespread in free-living cyanobacteria (e.g., Synechocystis) and rhizobia (e.g., S. meliloti) but absent in some marine strains (e.g., Prochlorococcus) and endosymbionts . This suggests adaptability to varied ecological niches.

Future Directions

  1. Structural Elucidation: High-resolution crystallography of NtrY’s PAS-heme complex to map signal transduction.

  2. Synthetic Biology: Designing recombinant NtrY variants to enhance nitrogen utilization in bioremediation or food production.

  3. Systems Biology: Integrating NtrY/NtrX networks with broader metabolic models to predict regulatory outcomes.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Nitrogen regulation protein NtrY homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-777
Protein Length
full length protein
Species
Azospirillum brasilense
Target Protein Sequence
MSPTPPETVTPLWQQFLRWAARVGLAKRLAFALSLAALVAGFATYTALTESAPFGETNPR TVTWLLTLDLALLLLLGVLIARRIVYLWIGRRRGLAGSQMHVRLVAVFSLLAVAPAIIMA IFSTVFFYVGVQSWFSERVRTAVNESLAVASAYLHEHQQNIRADALAMANDLNQEAARLA SDPERFEQVVATQAMLRALSEAIVFNGTTGAIVARSGYTFALEFDPIPDDKLATARRGEV AMIVSENDDRVRALVRLDRFADTYLYVGRMVEPRVLSHMASAEGAVREFGALESQRGSLQ ITFTLIFLCVALLLLLAAVWAGLIFATRLVRPISALIGAADRVRAGDLTVRVTERPAEDD LALLSRAFNRMTTEIESQRHALLSANRLIDSRRRFTETVLSGVSAGRDGLDAEGRITLSK FSAARLLGVKDAESLIGMRLAELVPEMGGLLHEAPGRPGLVVQDQIKIRRDGTTPLTLLV RISTEGRGSGMMRGYVVTFDEHHRTWSPAQRKAAWARRRPIAASPTRVKNPLTPIQLSAE PCAASTLKEITSDTEVFTMCTDTIVRQVDDIRRMVDEFSAFARMPQPVMKPCNLNDLVRQ AVFLQSSAHAGKIKFDMALPQGPLTVPCDSRQISQALTNLLQNAADAIEGRPPPAEGTEL PPGHVAIRVEADAERIAMIIEDNGKGLPTEERDRLTEPYVTTRAKGTGLGLAIVKKIMED HGGVLTLEDREGGGARVGLVIPQHIPPASGTAAGDAPGGVGTPAETGEEKRHAAHGA
Uniprot No.

Target Background

Function
NtrY is a member of the two-component regulatory system NtrY/NtrX, which plays a crucial role in regulating nitrogen levels. NtrY is believed to activate NtrX through phosphorylation.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Nitrogen regulation protein NtrY homolog and what is its primary function?

The Nitrogen regulation protein NtrY is part of a two-component regulatory system (NtrY/NtrX) first discovered in Azorhizobium caulinodans that regulates nitrogen metabolism under free-living conditions. NtrY functions as a histidine kinase that senses environmental nitrogen conditions and transmits signals by phosphorylating its cognate response regulator, NtrX. This system significantly affects nodulation and nitrogen fixation in host plants such as Sesbania rostrata . In various bacterial species, NtrY homologs participate in micro-oxygen signaling and nitrogen respiration, as observed in Brucella abortus . The NtrY/NtrX system has evolved to control multiple physiological processes beyond nitrogen metabolism, including cell envelope formation, cellular redox homeostasis, and cell division regulation, demonstrating its role as a master regulator that coordinates bacterial metabolism with environmental conditions .

How do NtrY homologs differ across bacterial species?

NtrY homologs exhibit significant functional diversity across bacterial species while maintaining their core role in nitrogen metabolism regulation. In Rhizobium tropici, NtrY/NtrX homologs regulate both nitrogen metabolism and symbiotic nodulation . In Azospirillum brasilense and Herbaspirillum seropedicae, these homologs specifically regulate nitrate uptake . Rhodobacter capsulatus demonstrates a broader regulatory scope, where NtrY/NtrX simultaneously controls nitrogen metabolism and cellular redox homeostasis . In Neisseria gonorrhoeae, NtrX controls the expression of respiratory enzymes . The NtrY/NtrX system in Ehrlichia chaffeensis has evolved to regulate cell proliferation, amino acid metabolism, and CtrA degradation . These functional differences reflect evolutionary adaptations to specific ecological niches and metabolic requirements, while maintaining the conserved two-component signaling architecture.

What is the molecular mechanism of NtrY/NtrX signal transduction?

The NtrY/NtrX system operates through a canonical two-component phosphorelay mechanism. NtrY functions as a membrane-bound histidine kinase that autophosphorylates at a conserved histidine residue in response to nitrogen limitation signals. This phosphate group is then transferred to a conserved aspartate residue (the 53rd aspartate in Sinorhizobium meliloti NtrX) in the receiver domain of the response regulator NtrX . Phosphorylated NtrX binds to specific DNA sequences (CAAN1-5TTG) in the promoter regions of target genes, directly regulating their transcription . In S. meliloti, phosphorylated NtrX binds to the promoter regions of cell cycle regulatory genes including ctrA, gcrA, dnaA, and ftsZ1 . The phosphorylation state of NtrX is therefore essential for proper regulation of nitrogen metabolism and cell division, with phosphorylation occurring both in vitro and in vivo .

What are the challenges in purifying recombinant NtrY homologs and how can they be addressed?

Purification of recombinant NtrY homologs presents several challenges due to their membrane-associated nature and functional requirements. The primary difficulties include: (1) Low solubility of the full-length protein containing transmembrane domains; (2) Maintaining the native conformation during extraction from membranes; and (3) Preserving kinase activity throughout purification.

To address these challenges, researchers should implement the following strategies:

  • For full-length NtrY purification:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for membrane solubilization

    • Include stabilizing agents such as glycerol (10-15%) and reducing agents in all buffers

    • Apply a step-wise detergent exchange during purification to find the optimal detergent for stability

  • For cytoplasmic domain purification:

    • Express only the cytoplasmic portion (containing the DHp and CA domains) to avoid membrane extraction

    • Utilize affinity chromatography followed by ion exchange and size exclusion chromatography

    • Include ATP or non-hydrolyzable ATP analogs in purification buffers to stabilize the kinase domain

Optimization of imidazole concentrations during nickel affinity chromatography is crucial to minimize non-specific binding while maximizing target protein recovery.

How can the functional activity of purified recombinant NtrY be verified?

Verification of functional activity for purified recombinant NtrY requires assessment of both its autophosphorylation capability and phosphotransfer activity to NtrX. The following methodologies provide comprehensive functional characterization:

  • Autophosphorylation assay:

    • Incubate purified NtrY with [γ-32P]ATP in buffer containing Mg2+ or Mn2+

    • Analyze phosphorylation by SDS-PAGE followed by autoradiography

    • Alternatively, use Phos-tag SDS-PAGE for non-radioactive detection of phosphorylated species

  • Phosphotransfer assay:

    • Assess the ability of autophosphorylated NtrY to transfer the phosphoryl group to purified NtrX

    • Confirm phosphorylation of NtrX at the conserved aspartate residue (position 53 in S. meliloti NtrX) using mass spectrometry

    • Measure the kinetics of phosphotransfer using stopped-flow techniques or quenched-flow approaches

  • DNA binding assay:

    • Verify that phosphorylated NtrX can bind to its target DNA sequences (CAAN1-5TTG) using electrophoretic mobility shift assays (EMSA)

    • Alternatively, employ surface plasmon resonance (SPR) or microscale thermophoresis (MST) to determine binding affinities

Additionally, circular dichroism spectroscopy should be used to confirm proper protein folding, and thermal shift assays can assess stability under different buffer conditions.

What structural features are essential for NtrY homolog function?

NtrY homologs contain several conserved structural domains essential for their sensory and kinase functions. The protein architecture typically includes:

  • N-terminal periplasmic sensing domain:

    • Recognizes environmental nitrogen signals

    • Contains conserved amino acid binding pockets in some species

    • Shows the highest sequence variability among NtrY homologs, reflecting adaptation to specific nitrogen sources

  • Transmembrane domains:

    • Anchor the protein to the inner membrane

    • Transmit conformational changes from the periplasmic to the cytoplasmic domains

  • HAMP domain:

    • Acts as a signal converter between the transmembrane and kinase domains

    • Undergoes conformational changes upon signal recognition

  • Dimerization and Histidine phosphotransfer (DHp) domain:

    • Contains the conserved histidine residue that is autophosphorylated

    • Forms the interaction surface with NtrX during phosphotransfer

    • Mediates homodimerization of NtrY proteins

  • Catalytic and ATP-binding (CA) domain:

    • Binds ATP and catalyzes autophosphorylation of the conserved histidine

    • Shows high sequence conservation across bacterial species

Mutational studies have shown that alterations in the DHp domain significantly impair both autophosphorylation and phosphotransfer activities, while mutations in the periplasmic domain often lead to constitutive activity or signal insensitivity depending on the specific changes.

How does NtrX binding to DNA affect gene expression in different bacterial contexts?

Phosphorylated NtrX binds to specific DNA recognition sequences (CAAN1-5TTG) in the promoter regions of target genes to directly regulate their transcription . The regulatory impact varies across bacterial species and target genes:

  • In Sinorhizobium meliloti:

    • NtrX binding to the promoters of cell cycle regulatory genes (ctrA, gcrA) leads to their repression

    • Binding to dnaA and ftsZ1 promoters results in activation of these genes

    • This differential regulation coordinates cell division with nitrogen availability

  • In Pseudomonas stutzeri A1501:

    • NtrX regulates 1431 genes, with 147 containing direct NtrX-binding sites

    • It controls nitrogen fixation, nitrogenous compound acquisition, catabolism, and nitrate assimilation

    • It also regulates oxidative stress response genes like katB to protect nitrogenase from oxygen damage

  • In other bacteria:

    • NtrX regulates respiratory enzymes in Neisseria gonorrhoeae

    • Controls cell envelope formation in Rhodobacter sphaeroides

    • Regulates cell proliferation and amino acid metabolism in Ehrlichia chaffeensis

The regulatory outcomes (activation vs. repression) depend on the precise binding site position relative to the transcription start site, interaction with RNA polymerase, and cooperation with other transcription factors.

What experimental approaches are most effective for identifying NtrX binding sites genome-wide?

Identifying NtrX binding sites genome-wide requires complementary experimental approaches that provide both high-resolution binding data and functional validation:

  • Chromatin Immunoprecipitation followed by Sequencing (ChIP-seq):

    • Requires specific anti-NtrX antibodies or epitope-tagged NtrX proteins

    • Provides an unbiased genome-wide map of binding sites

    • In S. meliloti, this approach identified 82 DNA fragments bound by NtrX (60 from the chromosome and 22 from plasmids)

  • DNA Affinity Purification sequencing (DAP-seq):

    • Uses purified, phosphorylated NtrX protein with genomic DNA libraries

    • Avoids potential artifacts from in vivo protein-protein interactions

    • Can be performed with varying NtrX phosphorylation states to distinguish condition-specific binding

  • Motif analysis:

    • Computational identification of the CAAN1-5TTG binding motif across genomes

    • Position weight matrices development from experimentally validated sites

    • Phylogenetic footprinting to identify conserved motifs across related species

  • Functional validation:

    • Combine binding data with transcriptomics (RNA-seq) to correlate binding with expression changes

    • In P. stutzeri, RNA-seq identified 1431 genes affected by ntrC deletion

    • Reporter assays using promoter-reporter fusions to validate direct regulation

    • Site-directed mutagenesis of predicted binding sites to confirm functionality

The integration of these approaches provides a comprehensive understanding of the NtrX regulon and distinguishes direct from indirect regulatory effects.

How does the NtrY/NtrX system integrate nitrogen metabolism with cell cycle regulation?

The NtrY/NtrX system functions as a master regulatory hub that integrates environmental nitrogen sensing with critical cellular processes, particularly cell cycle progression. This integration occurs through several mechanisms:

  • Direct transcriptional regulation:

    • In S. meliloti, phosphorylated NtrX directly binds to the promoter regions of key cell cycle regulatory genes, including ctrA, gcrA, dnaA, and ftsZ1

    • This binding affects transcription, with upregulation of ctrA and gcrA and downregulation of dnaA and ftsZ1 observed in ntrX mutants

    • The regulatory effect is mediated through NtrX recognition of the CAAN1-5TTG sequence motif in target promoters

  • Protein level regulation:

    • Western blotting experiments demonstrate that NtrX affects CtrA and GcrA protein levels, with apparent increases observed in ntrX mutants

    • This suggests that NtrX might also indirectly influence post-transcriptional regulation

  • Phenotypic consequences:

    • ntrX mutants exhibit significant cell division defects:

      • Slow growth

      • Abnormal cell morphology

      • Delayed DNA synthesis

    • These phenotypes indicate that proper NtrX function is essential for normal cell cycle progression

  • Cross-species conservation:

    • Expression of phosphorylation site-substituted NtrX in Agrobacterium tumefaciens resulted in altered growth phenotypes

    • This suggests that the NtrX-mediated cell cycle regulation mechanism is conserved across alphaproteobacteria

This regulatory network ensures that cell division is appropriately coordinated with nitrogen availability, preventing energy-intensive cell division under nutrient-limited conditions.

What phenotypic changes are observed in NtrY/NtrX mutants and what do they reveal about function?

NtrY/NtrX mutants exhibit diverse phenotypic changes that provide insights into the multifaceted roles of this regulatory system:

  • Growth and cell division defects:

    • S. meliloti ntrX mutants show slow growth

    • Abnormal cell morphology is observed in a subset of cells

    • DNA synthesis is delayed, indicating disruption of the cell cycle

    • These phenotypes demonstrate NtrX's crucial role in regulating cell division

  • Nitrogen metabolism alterations:

    • P. stutzeri A1501 ntrC mutants show impaired utilization of alternative nitrogen sources

    • Analysis of 1431 differentially expressed genes in ntrC mutants reveals widespread effects on nitrogen metabolism pathways

    • This confirms the primary role of the NtrY/NtrX system in nitrogen metabolism regulation

  • Stress response changes:

    • Oxidative stress-related gene (katB) expression is upregulated in ntrC deletion mutants

    • This suggests that NtrX is involved in protecting nitrogenase from oxygen damage

    • The mutants likely have altered redox homeostasis

  • Symbiotic defects:

    • In nodule-forming bacteria, mutants show impaired nodulation and nitrogen fixation

    • This indicates the importance of this system in plant-microbe interactions

  • Environmental adaptation:

    • NtrX is required for survival of C. crescentus cells under low pH conditions

    • This suggests a role in pH homeostasis and environmental stress adaptation

Collectively, these phenotypes reveal that NtrY/NtrX functions as a high-ranking regulatory system that coordinates nitrogen metabolism with cell division, stress responses, and environmental adaptation.

What is the relationship between NtrY/NtrX and other nitrogen regulatory systems like NtrB/NtrC?

The relationship between NtrY/NtrX and other nitrogen regulatory systems like NtrB/NtrC represents a complex network of interactions that coordinates bacterial responses to nitrogen availability:

This complex relationship allows bacteria to integrate multiple nitrogen-related signals and coordinate appropriate metabolic and cellular responses.

What are the key considerations for designing genetic knockouts of ntrY homologs?

Designing effective genetic knockouts of ntrY homologs requires careful consideration of several factors to ensure valid experimental outcomes:

  • Knockout strategy selection:

    • For complete functional disruption, a sacB-based deletion strategy is recommended, as demonstrated for ntrC in P. stutzeri

    • Scarless deletion methods minimize polar effects on downstream genes

    • For conditional knockouts, consider inducible systems like Tet-OFF or temperature-sensitive replicons

  • Operon structure analysis:

    • NtrY is often co-transcribed with NtrX in many bacteria

    • Deletion design must avoid disrupting the expression of NtrX or other downstream genes

    • RT-PCR should be performed to verify the absence of polar effects

  • Complementation controls:

    • Essential for confirming phenotype specificity to ntrY disruption

    • Use broad host plasmids like pLAFR3 for complementation, as used for ntrC and cbrB in P. stutzeri

    • Include the native promoter and terminator regions in complementation constructs

  • Verification methods:

    • Confirm knockout using PCR with primers flanking the deletion site (testF/testR)

    • Sequence verification is essential to ensure precise deletion

    • Western blotting with anti-NtrY antibodies to confirm absence of protein

  • Consideration of potential redundancy:

    • Some bacteria contain multiple histidine kinases that may partially compensate for NtrY loss

    • Consider creating double/triple mutants with related kinases

    • Analyze expression changes in other kinases following ntrY deletion

  • Phenotypic characterization:

    • Assess growth under various nitrogen sources

    • Examine cell morphology, as ntrX mutants show abnormal cell shapes

    • Measure DNA synthesis rates, which are delayed in ntrX mutants

Proper documentation of knockout construction using precise molecular techniques ensures reproducibility and validity of subsequent functional analyses.

How can researchers effectively study the phosphorylation dynamics of the NtrY/NtrX system?

Studying phosphorylation dynamics of the NtrY/NtrX system requires specialized techniques that capture the transient nature of these modifications and their functional consequences:

  • In vitro phosphorylation assays:

    • Purify recombinant NtrY cytoplasmic domain and full-length NtrX

    • Monitor autophosphorylation of NtrY using [γ-32P]ATP

    • Track phosphotransfer from NtrY to NtrX over time courses

    • Use phosphomimetic mutants (D53E in NtrX) to study constitutive activation

  • Mass spectrometry approaches:

    • Identify phosphorylation sites using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Specifically look for phosphorylation at the conserved 53rd aspartate residue in NtrX

    • Quantify phosphorylation stoichiometry using AQUA peptides

    • Compare phosphorylation levels under different nitrogen conditions

  • Phosphorylation-specific antibodies:

    • Develop antibodies that specifically recognize phosphorylated NtrX

    • Use for western blotting and immunoprecipitation experiments

    • Enable in vivo tracking of NtrX phosphorylation states

  • Phos-tag SDS-PAGE:

    • Separate phosphorylated and non-phosphorylated forms of NtrX

    • Monitor phosphorylation kinetics without radioactivity

    • Quantify relative abundances of different phosphorylation states

  • Phosphorylation-dependent DNA binding:

    • Use EMSAs to assess DNA binding of phosphorylated versus non-phosphorylated NtrX

    • Quantify binding affinity differences to the CAAN1-5TTG motif

    • Employ chromatin immunoprecipitation (ChIP) to identify in vivo binding sites

  • Fluorescence resonance energy transfer (FRET) sensors:

    • Design FRET-based reporters for real-time monitoring of NtrX phosphorylation

    • Monitor phosphorylation dynamics in live cells

    • Correlate with environmental nitrogen fluctuations

These techniques provide complementary data on phosphorylation dynamics, enabling researchers to understand the temporal aspects of NtrY/NtrX signaling under various nitrogen conditions.

What approaches can be used to study the NtrY/NtrX regulon across different bacterial species?

Studying the NtrY/NtrX regulon across different bacterial species requires integrative approaches that account for evolutionary divergence while identifying conserved regulatory mechanisms:

  • Comparative transcriptomics:

    • Perform RNA-seq on wild-type and ntrY/ntrX mutants across multiple species

    • In P. stutzeri A1501, RNA-seq identified 1431 genes affected by ntrC deletion

    • Compare differentially expressed genes to identify core conserved regulons

    • Focus analysis on nitrogen metabolism and cell cycle regulation pathways

  • Chromatin immunoprecipitation approaches:

    • Conduct ChIP-seq using species-specific anti-NtrX antibodies

    • Alternatively, use epitope-tagged NtrX expressed at native levels

    • In S. meliloti, ChIP identified 82 DNA fragments bound by NtrX

    • Compare binding sites across species to identify conserved targets

  • Motif analysis and regulon prediction:

    • Use the CAAN1-5TTG consensus sequence to predict binding sites across genomes

    • Develop position weight matrices from experimentally validated sites

    • Apply phylogenetic footprinting to identify evolutionarily conserved regulatory regions

    • Validate predicted sites using reporter assays

  • Heterologous expression studies:

    • Express NtrX from one species in another to test functional conservation

    • As demonstrated with S. meliloti NtrX in A. tumefaciens

    • Assess complementation of growth and cell division phenotypes

  • Systems biology integration:

    • Combine transcriptomics, ChIP-seq, and metabolomics data

    • Construct species-specific and pan-species regulatory network models

    • Identify convergent and divergent regulatory mechanisms

  • Evolutionary analysis:

    • Perform phylogenetic analysis of NtrY/NtrX proteins across bacterial lineages

    • Correlate sequence divergence with functional differences

    • Identify lineage-specific adaptations in regulon composition

This multi-faceted approach enables identification of both the core conserved NtrY/NtrX regulon and species-specific regulatory innovations, providing insights into how this signaling system has evolved to meet diverse ecological challenges.

How does the NtrY/NtrX system interact with the KNO1-mediated DNA damage response pathway?

The interaction between the NtrY/NtrX system and the KNO1-mediated DNA damage response represents an emerging area of research that connects nitrogen metabolism with genome stability:

  • Regulatory overlap:

    • KNO1 is involved in the DNA damage response (DDR), with kno1 mutants showing hypersensitivity to DNA damaging agents

    • KNO1 accumulates in the nucleus after DNA damage, partially colocalizing with γH2AX foci

    • NtrY/NtrX regulates cell cycle progression through direct binding to promoters of cell cycle regulatory genes

    • Both pathways appear to respond to environmental stresses and influence DNA metabolism

  • Potential signaling integration:

    • KNO1 functions in downregulating the RTR component RMI1 after cross-linker-induced DNA damage

    • This regulation involves K63 ubiquitination and autophagy-mediated degradation

    • NtrY/NtrX might influence this process through its effects on cell cycle regulators like CtrA

    • The precise interaction mechanisms remain to be fully elucidated

  • Shared protein interaction networks:

    • KNO1 interacts with DNA repair proteins including components of the 9-1-1 complex (Rad9, Rad1, and Hus1)

    • The 9-1-1 complex plays roles in DNA damage checkpoint signaling and error-free DNA damage tolerance pathways

    • NtrY/NtrX could potentially influence these interactions through its regulation of cell cycle and DNA replication

  • Experimental approaches to study interactions:

    • Generate ntrY/ntrX and kno1 double mutants to assess genetic interactions

    • Perform co-immunoprecipitation experiments to identify shared protein complexes

    • Use transcriptomics to compare gene expression profiles of single and double mutants

    • Assess DNA damage sensitivity and repair efficiency in mutant combinations

Understanding these interactions could provide insights into how bacteria coordinate nitrogen metabolism with DNA repair mechanisms to maintain genomic integrity during environmental stress.

What are the emerging therapeutic applications targeting the NtrY/NtrX system in pathogenic bacteria?

The NtrY/NtrX system's critical roles in bacterial pathogenesis make it an attractive target for antimicrobial development, with several emerging therapeutic approaches:

  • Targeting NtrY kinase activity:

    • Design of ATP-competitive inhibitors that specifically block the catalytic domain

    • Development of allosteric modulators that lock NtrY in an inactive conformation

    • These approaches could disrupt nitrogen sensing and virulence regulation in pathogens like Brucella and Neisseria

  • Disrupting NtrY-NtrX interaction:

    • Peptide-based or small molecule inhibitors that prevent phosphotransfer

    • This would block signal transduction while preserving host cell signaling pathways

    • Potentially effective against pathogens where NtrY/NtrX regulates virulence factors

  • Targeting NtrX DNA binding:

    • Small molecules that bind to the CAAN1-5TTG recognition sequence

    • DNA-binding competitive inhibitors that prevent transcriptional regulation

    • This approach could selectively disrupt pathogen metabolism and division

  • Therapeutic potential in specific pathogens:

    • In Neisseria gonorrhoeae, where NtrX controls respiratory enzymes

    • In Brucella abortus, where NtrY participates in micro-oxygen signaling essential for intracellular survival

    • In Ehrlichia chaffeensis, where NtrY/NtrX regulates cell proliferation and amino acid metabolism

  • Combination therapy approaches:

    • Synergistic use with conventional antibiotics to enhance efficacy

    • Targeting NtrY/NtrX to disrupt bacterial adaptation to antibiotic stress

    • Potentially effective against persistent or dormant infections

  • Challenges and considerations:

    • Selectivity for bacterial versus host signaling systems

    • Penetration of inhibitors through bacterial membranes

    • Potential for resistance development through compensatory mutations

These emerging therapeutic applications highlight the potential of the NtrY/NtrX system as a novel target for antimicrobial development, particularly for pathogens with limited treatment options.

How can systems biology approaches enhance our understanding of NtrY/NtrX regulatory networks?

Systems biology approaches offer powerful frameworks for understanding the complex NtrY/NtrX regulatory networks across diverse bacterial species:

  • Multi-omics integration:

    • Combine transcriptomics (RNA-seq) data from NtrY/NtrX mutants with proteomics and metabolomics

    • In P. stutzeri, transcriptomics identified 1431 genes affected by ntrC deletion

    • Integrate ChIP-seq data identifying direct binding sites (like the 82 sites found in S. meliloti)

    • Correlate phosphoproteomics data to identify broader effects of NtrY/NtrX signaling

    • This integration reveals direct versus indirect regulation and metabolic consequences

  • Network modeling approaches:

    • Construct directed regulatory networks with NtrY/NtrX as hub regulators

    • Include downstream transcription factors and their targets

    • Incorporate feedback loops and feed-forward mechanisms

    • Apply dynamic modeling to predict system behavior under changing nitrogen conditions

  • Comparative systems analysis:

    • Compare NtrY/NtrX regulatory networks across diverse bacterial species

    • Identify evolutionary conservation and divergence in network architecture

    • Correlate network differences with ecological adaptations

    • Discover emergent properties in specialized networks (e.g., symbiotic versus pathogenic bacteria)

  • Genome-scale metabolic modeling:

    • Incorporate NtrY/NtrX regulation into constraint-based metabolic models

    • Predict metabolic flux redistributions in response to nitrogen limitation

    • Simulate growth phenotypes of NtrY/NtrX mutants under various conditions

    • Identify metabolic vulnerabilities in network perturbations

  • Advanced computational approaches:

    • Apply machine learning to predict novel NtrY/NtrX targets

    • Use network inference algorithms to reconstruct signaling pathways from experimental data

    • Develop predictive models of bacterial adaptation to nitrogen fluctuations

    • Implement Boolean network models to simulate regulatory logic

  • Data visualization and integration tools:

    • Develop specialized visualization tools for multi-layered regulatory networks

    • Create accessible databases of NtrY/NtrX regulons across bacterial species

    • Implement interactive modeling platforms for hypothesis testing

These systems biology approaches provide a comprehensive understanding of how NtrY/NtrX coordinates nitrogen metabolism with other cellular processes, revealing emergent properties not apparent from reductionist approaches.

What are the most promising directions for advancing our understanding of NtrY/NtrX function?

The study of NtrY/NtrX systems presents several promising research directions that could significantly advance our understanding of bacterial regulatory networks:

  • Structural biology approaches:

    • Determine high-resolution structures of full-length NtrY and NtrX proteins

    • Capture different conformational states (inactive, active, DNA-bound)

    • Elucidate the structural basis for phosphorylation-dependent DNA binding to the CAAN1-5TTG motif

    • Apply cryo-EM to visualize complete NtrY/NtrX complexes in membrane environments

  • Single-cell analysis:

    • Investigate cell-to-cell variability in NtrY/NtrX signaling

    • Develop fluorescent reporters for real-time monitoring of NtrX activity

    • Correlate signaling dynamics with cell cycle progression and division

    • Examine heterogeneity in bacterial populations responding to nitrogen fluctuations

  • Host-microbe interactions:

    • Explore how NtrY/NtrX influences symbiotic relationships in nodule-forming bacteria

    • Investigate pathogen-host interactions mediated by NtrY/NtrX signaling

    • Determine how host nitrogen availability affects bacterial virulence through this pathway

    • Study potential modulation of NtrY/NtrX by host defense mechanisms

  • Evolution and adaptation:

    • Analyze NtrY/NtrX sequence and functional evolution across bacterial lineages

    • Investigate how this system has been repurposed for diverse functions beyond nitrogen regulation

    • Explore the evolutionary relationship with other two-component systems

    • Apply experimental evolution to study adaptation of this regulatory network

  • Environmental sensing mechanisms:

    • Identify the direct signals sensed by NtrY in different bacterial species

    • Determine the molecular mechanisms of signal perception

    • Investigate cross-talk with other environmental sensing pathways

    • Explore the sensitivity and dynamic range of the NtrY/NtrX system

  • Synthetic biology applications:

    • Engineer NtrY/NtrX variants with altered specificity and sensitivity

    • Develop biosensors based on modified NtrY/NtrX systems

    • Create synthetic regulatory circuits incorporating NtrY/NtrX components

    • Design bacteria with programmed responses to nitrogen availability

These research directions will provide deeper insights into how NtrY/NtrX functions as a master regulator coordinating nitrogen metabolism with cell cycle regulation and environmental adaptation.

What technological advancements would most benefit research on NtrY homologs?

Several technological advancements would significantly accelerate research on NtrY homologs and their regulatory networks:

  • Improved membrane protein expression and purification:

    • Development of standardized protocols for full-length NtrY expression

    • Novel detergents and nanodiscs optimized for histidine kinase stabilization

    • High-throughput purification platforms for membrane-bound sensor kinases

    • These would facilitate structural and biochemical studies of intact NtrY proteins

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize NtrY/NtrX localization in bacterial cells

    • Single-molecule tracking to monitor NtrY dynamics in membranes

    • FRET-based sensors for real-time visualization of phosphotransfer events

    • These would reveal spatial and temporal aspects of signaling

  • Rapid mutagenesis and phenotyping:

    • CRISPR-Cas9 systems optimized for diverse bacterial species

    • High-throughput phenotyping platforms to assess growth under varied nitrogen sources

    • Automated cell morphology analysis systems

    • These would accelerate functional genomics studies across bacterial species

  • Phosphoproteomics advancements:

    • Improved enrichment methods for bacterial phosphoproteins

    • Higher sensitivity mass spectrometry for low-abundance phosphopeptides

    • Targeted approaches for monitoring NtrX phosphorylation dynamics

    • These would reveal the comprehensive impact of NtrY/NtrX signaling

  • In situ structural biology:

    • Cryo-electron tomography of bacterial cells to visualize native NtrY complexes

    • In-cell NMR to monitor structural changes during signaling

    • These would provide structural insights in physiological contexts

  • Computational tools:

    • Improved algorithms for predicting NtrX binding sites based on the CAAN1-5TTG motif

    • Machine learning approaches for regulatory network inference

    • Molecular dynamics simulations of NtrY/NtrX signaling

    • These would enhance interpretation of experimental data and guide hypothesis generation

  • Microfluidics and single-cell technologies:

    • Microfluidic devices for precise control of nitrogen availability

    • Single-cell RNA-seq to capture heterogeneity in bacterial responses

    • These would reveal population dynamics and cell-to-cell variability

These technological advancements would collectively transform our ability to study NtrY homologs across diverse bacterial species and environmental conditions.

How might understanding NtrY/NtrX systems contribute to sustainable agriculture and biotechnology?

Understanding NtrY/NtrX systems has significant potential to advance sustainable agriculture and biotechnology through multiple applications:

  • Enhancing biological nitrogen fixation:

    • Engineering improved NtrY/NtrX signaling in symbiotic nitrogen-fixing bacteria

    • In P. stutzeri A1501, a model strain for associative nitrogen fixation, NtrC controls multiple nitrogen fixation pathways

    • Optimizing regulatory networks to increase nitrogen fixation efficiency

    • Developing bacteria with enhanced ability to transfer fixed nitrogen to crop plants

    • This could reduce dependence on chemical fertilizers and their environmental impacts

  • Plant growth-promoting rhizobacteria (PGPR) development:

    • Engineering NtrY/NtrX systems in PGPR to optimize nitrogen transfer to plants

    • Creating bacteria with fine-tuned responses to root exudates and soil nitrogen

    • Designing robust bacteria that maintain plant interactions under environmental stress

    • This could enhance crop yields while reducing fertilizer inputs

  • Bioremediation applications:

    • Optimizing NtrY/NtrX regulation in bacteria capable of degrading nitrogen-containing pollutants

    • Engineering microbial consortia with coordinated nitrogen metabolism

    • Developing biosensors based on NtrY/NtrX to monitor environmental nitrogen levels

    • This could improve cleanup of agricultural runoff and industrial waste

  • Bioproduction of nitrogen-rich compounds:

    • Metabolic engineering using NtrY/NtrX regulatory elements to control biosynthetic pathways

    • Creating bacterial strains with optimized nitrogen metabolism for production of amino acids, antibiotics, and other valuable compounds

    • Developing inducible systems based on NtrY/NtrX components

    • This could enhance industrial production of nitrogen-containing biochemicals

  • Synthetic biology applications:

    • Incorporating NtrY/NtrX components into synthetic genetic circuits

    • Designing bacteria with programmed responses to environmental nitrogen

    • Creating biological computers using NtrY/NtrX-based logic gates

    • This could enable sophisticated engineered microbes for various applications

  • Understanding microbial ecology:

    • Elucidating how NtrY/NtrX systems influence microbial community dynamics

    • Predicting ecosystem responses to nitrogen perturbations

    • Designing balanced microbial communities for sustainable agriculture

    • This could improve management of agricultural and natural ecosystems

These applications leverage the fundamental understanding of NtrY/NtrX signaling to address critical challenges in agriculture, environmental management, and industrial biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.