Recombinant Nitrosococcus oceani Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
dsbB; Noc_2599; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Target Names
dsbB
Target Protein Sequence
MRLSVRWVFFLGFFLCALMLAIAGYFQFVENLEPCPLCILSRVAVLAIGGVFLVAALHNP KSWGIKVYALLGFVVTLIGIGITGRHVWLQSLPADQVPACGPGLNFMLDNFPLTETLELV FRGSGECAEVQWSFLGLTIPGWTLVAFLFLGVISLWQMGRTGGGAGKLT
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the disulfide bond formation (Dsb) system in Nitrosococcus oceani?

The Dsb system in N. oceani, similar to that observed in related bacteria like N. europaea, is responsible for the oxidative folding of proteins in the periplasmic space. This system plays a critical role in maintaining protein structure and function, particularly during oxidative stress conditions. In N. europaea, proteins such as DsbA and DsbC were found to be 1.5 and three times more abundant, respectively, during oxidative stress responses . DsbB specifically functions to reoxidize DsbA, maintaining the electron flow in the disulfide bond formation pathway. This system is particularly important for N. oceani as a marine ammonia oxidizer that frequently encounters oxidative stress in its natural habitat.

How does the genomic context of dsbB in N. oceani compare to other nitrifying bacteria?

Based on genomic analyses of N. oceani, the dsbB gene would be expected to be located within the context of other redox-related genes. The complete genome sequence of N. oceani (ATCC 19707) consists of a single circular chromosome (3,481,691 bp; G+C content of 50.4%) and a plasmid (40,420 bp) containing 3,052 and 41 candidate protein-encoding genes, respectively . Unlike the multiple copies of genes involved in ammonia oxidation found in some bacteria, N. oceani appears to maintain single copies of many functional genes. When studying dsbB, researchers should consider examining its genomic neighborhood for co-regulated genes involved in oxidative stress response or protein folding.

What expression systems are most effective for producing recombinant N. oceani DsbB protein?

For membrane proteins like DsbB from N. oceani, E. coli-based expression systems have proven effective, as demonstrated with other N. oceani proteins . The methodology for expression includes:

  • Gene synthesis or PCR amplification of the dsbB gene from N. oceani genomic DNA

  • Cloning into an expression vector with an appropriate tag (His-tag is commonly used)

  • Transformation into an E. coli expression strain optimized for membrane proteins (C41(DE3) or C43(DE3))

  • Expression at lower temperatures (16-20°C) to facilitate proper folding

  • Induction with lower IPTG concentrations (0.1-0.5 mM)

For purification, a combination of detergent solubilization (e.g., n-dodecyl-β-D-maltoside) followed by immobilized metal affinity chromatography has shown success with similar membrane proteins from N. oceani .

How can the enzymatic activity of recombinant N. oceani DsbB be measured in vitro?

The enzymatic activity of recombinant N. oceani DsbB can be assessed through several complementary approaches:

  • Ubiquinone reduction assay: Measuring the reduction of ubiquinone by monitoring absorbance decrease at 275 nm in the presence of reduced DsbA and purified DsbB.

  • Coupled assay with DsbA: Using DsbA-dependent oxidation of a substrate (like reduced insulin) as an indirect measure of DsbB activity.

  • Direct measurement of disulfide exchange: Employing mass spectrometry to track the oxidation state of cysteine residues in DsbA following incubation with DsbB.

These assays should be performed under conditions that mimic the marine environment from which N. oceani originates, including appropriate salt concentrations (typically 30-35 g/L NaCl) and pH values (7.5-8.2).

What are the structural features that distinguish N. oceani DsbB from other bacterial DsbB proteins?

While specific structural data for N. oceani DsbB is not detailed in the search results, comparative analysis with homologous proteins suggests several key features:

  • As a membrane protein, N. oceani DsbB likely contains four transmembrane domains with two periplasmic loops containing conserved cysteine residues.

  • Being from a marine organism adapted to saline environments, N. oceani DsbB may possess amino acid variations that enhance stability under higher ionic strength conditions.

  • Given the oxidative stress responses observed in Nitrosococcus species , the redox-active sites in DsbB may exhibit specialized features for functioning under fluctuating oxidative conditions typical in marine environments.

Researchers should consider employing homology modeling based on existing bacterial DsbB structures, followed by site-directed mutagenesis of predicted key residues to confirm functional importance.

How is expression of dsbB regulated in response to environmental stressors in N. oceani?

Based on studies of related systems, dsbB expression in N. oceani likely responds to multiple environmental stressors:

  • Oxidative stress: Similar to observations in N. europaea, oxidative stress significantly impacts the Dsb system . Proteins involved in disulfide bond formation were upregulated 1.5 to 3-fold under oxidative stress conditions.

  • Salinity changes: N. oceani, as a marine organism, encounters variations in salinity. Stress response in related organisms includes modifications in cell permeability and transmembrane transport regulation .

  • Ammonium availability: Transcriptomic studies of N. oceani have shown that energy status significantly affects gene expression patterns. When comparing ammonium-induced to ammonium-starved conditions, transcript levels varied from +30 to -16-fold across the genome , suggesting that energy substrate availability regulates numerous cellular processes including protein folding and stress responses.

To study dsbB regulation, researchers should employ qRT-PCR with N. oceani cultures exposed to various stressors, monitoring changes in dsbB transcript levels across different time points.

What is the relationship between the Dsb system and ammonia oxidation pathways in N. oceani?

The Dsb system likely supports ammonia oxidation in N. oceani through ensuring proper folding of periplasmic and membrane proteins involved in the electron transport chain. N. oceani oxidizes ammonia to hydroxylamine via ammonia monooxygenase, then to nitrite via hydroxylamine oxidoreductase, generating energy for the cell .

The integrity of these enzymes depends on proper disulfide bond formation. During transcriptional responses to ammonium and hydroxylamine, genes implicated in catabolic electron flow, carbon fixation, and stress tolerance were among the most highly expressed . This suggests that oxidative protein folding systems like the Dsb pathway may be coordinated with ammonia oxidation to maintain cellular redox balance.

Researchers investigating this relationship should consider dual-inhibitor studies targeting both the Dsb system and ammonia oxidation pathways to identify potential functional dependencies.

How can recombinant N. oceani DsbB be used to study protein folding mechanisms in marine chemolithoautotrophs?

Recombinant N. oceani DsbB provides a valuable tool for studying protein folding in marine bacteria adapted to saline environments:

  • Comparative folding kinetics: Using purified DsbB and DsbA from N. oceani to study oxidative folding of model substrates under varying salt concentrations, comparing with terrestrial bacterial homologs.

  • Interactome studies: Employing tagged DsbB to capture interaction partners from N. oceani cell lysates, revealing the network of proteins dependent on this folding pathway.

  • Adaptation mechanisms: Investigating how the N. oceani Dsb system has evolved to function optimally in marine environments through directed evolution experiments and comparative genomics.

Such studies would provide insights into how protein folding machinery adapts to specialized ecological niches, potentially revealing novel mechanisms relevant to protein engineering applications.

What approaches can be used to investigate the role of DsbB in N. oceani stress tolerance and environmental adaptation?

To investigate the role of DsbB in N. oceani stress tolerance, researchers can employ:

  • Gene knockout or knockdown studies: Creating dsbB-deficient N. oceani strains through genetic manipulation, then assessing phenotypic changes under various stress conditions.

  • Environmental simulation experiments: Exposing wild-type and dsbB-modified N. oceani to fluctuating environmental conditions (salinity, pH, oxidative stress) in controlled bioreactors while monitoring growth, ammonia oxidation rates, and global gene expression.

  • In situ proteomics: Analyzing the oxidation states of periplasmic proteins under various environmental conditions in both wild-type and dsbB-modified strains.

  • Heterologous complementation: Testing whether N. oceani dsbB can complement E. coli dsbB mutants under various stress conditions, particularly those mimicking marine environments.

This integrated approach would reveal the specific contribution of DsbB to N. oceani's ecological fitness in its native marine habitat.

What are common challenges when working with recombinant N. oceani DsbB and how can they be addressed?

Researchers working with recombinant N. oceani DsbB should anticipate several challenges:

  • Low expression yields: As a membrane protein, DsbB often expresses poorly. Address by optimizing codon usage for the expression host, testing multiple expression strains, and using specialized vectors designed for membrane proteins.

  • Protein misfolding: Membrane proteins frequently misfold when overexpressed. Improve by expressing at lower temperatures (16-20°C), using lower inducer concentrations, and adding folding enhancers like glycerol or specific detergents to the growth medium.

  • Detergent selection: Finding appropriate detergents for solubilization is critical. Screen multiple detergent types (maltoside derivatives, fos-cholines, or neopentyl glycols) for optimal activity retention.

  • Maintaining native interaction with redox partners: DsbB functions in a pathway with DsbA. Consider co-expression with its partner protein or supplementing purified DsbA during activity assays.

  • Activity verification: Confirming that recombinant DsbB retains native activity can be challenging. Employ multiple activity assays and compare with well-characterized DsbB proteins from other organisms.

What considerations are important when designing experiments to study DsbB interactions with other components of the disulfide formation pathway in N. oceani?

When studying DsbB interactions with other pathway components, consider:

  • Redox state preservation: Careful sample handling to maintain native redox states of cysteines during purification by including appropriate redox buffers.

  • Membrane environment reconstitution: DsbB is a membrane protein whose activity depends on the lipid environment. Consider reconstituting purified protein into liposomes or nanodiscs with lipid compositions mimicking the N. oceani membrane.

  • Interaction detection methods: Employ multiple complementary approaches such as surface plasmon resonance, isothermal titration calorimetry, and cross-linking mass spectrometry to verify interactions.

  • Specificity controls: Include controls with mutated cysteine residues and heterologous Dsb proteins to confirm the specificity of observed interactions.

  • Kinetic considerations: Design experiments that can capture the transient nature of disulfide exchange reactions, potentially using rapid kinetic methods or trapping intermediates through strategic mutations.

These considerations will help ensure that experimental results accurately reflect the native functions of the N. oceani disulfide formation pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.