Recombinant Nitrosococcus oceani Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order, and we will do our best to meet your requirements.
Lead Time
Delivery times may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
msbA; Noc_2675; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-597
Protein Length
full length protein
Species
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Target Names
msbA
Target Protein Sequence
MTFTPSLNSGLAVYRRLLSYTRPYRWIFAASIITMAIYAATETGLAALMKPLMDGSFIER DPATIQIIPLLLIGLFVIRGGANFITQYGLKWVARRVVRDLREQMFCHLLALPARYYDQK ASGQLLAKLIYDVEQVSNAATDAILTIIRDSLTILGLLAWMAYLNGLLTLIILVTAPLIA LIIWWVSHRFRRISRKIQNSMGDVSQVAQETIEGHREVKIFGGQTYEAERFDQVNEQNRR QTMKMAATDAISQPVVQLIAVLGLAGVIHLATRESMLAQISVGTFISFITAMMLLLGPVK RLTKINGTLQRGIAAAQSIFGLLAETPEADRGQQSLRRARGAIRFEHLSFCYEPAKGPVL ENIDLEIKPYQTIALVGHSGSGKSTLVSLLARFYETTSGRILIDEMDIQTLRLTELRRQI ALVSQQIILFNDTIAHNIAYGSYQQTSKQDIIRAAEAAHAMEFINRLPDGLDTVIGEKGV LLSGGQRQRLAIARALLKDAPILILDEATASLDTEAERHIQAALETLMRQRTTLVIAHRL STVENADQIIVLHQGQIIERGTHSQLLARESHYAGLYRLQFRHSHEHVSPLSANVGL
Uniprot No.

Target Background

Function
This protein plays a vital role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner leaflet of the inner membrane to the outer leaflet. The transmembrane domains (TMD) create a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its fundamental role in gram-negative bacteria?

MsbA functions as an essential ATP-binding cassette (ABC) transporter in gram-negative bacteria. Its primary role is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport function is critical for bacterial survival, as it enables the proper assembly of the outer membrane, which serves as a protective barrier against environmental stresses and antibiotics. MsbA is functionally characterized as a lipid flippase that can transport lipid A with or without attached core sugars .

The protein operates through an energy-dependent mechanism, utilizing ATP hydrolysis to power the conformational changes necessary for substrate translocation across the membrane. In experimental systems, MsbA typically exhibits ATPase activity in the range of 6–10 μmol ATP/min/mg protein when reconstituted in appropriate membrane environments .

What is the structural composition of MsbA from Nitrosococcus oceani?

The Nitrosococcus oceani MsbA is a full-length protein consisting of 597 amino acids . Its amino acid sequence begins with MTFTPSLNSG and continues through to VSPLSANVGL at the C-terminus . The protein is encoded by the msbA gene (locus name: Noc_2675) in the Nitrosococcus oceani genome (strain ATCC 19707 / NCIMB 11848) .

The structure of MsbA encompasses transmembrane domains that form a pathway for lipid substrates, and nucleotide-binding domains (NBDs) that bind and hydrolyze ATP. While the specific crystal structure of N. oceani MsbA has not been resolved according to the search results, structural studies of MsbA from other bacterial species (such as Salmonella typhimurium) have revealed important conformational states of this transporter family, including inward-facing conformations that display large amplitude openings in the transmembrane portal .

How can researchers effectively store and handle recombinant MsbA protein?

For optimal stability and activity, recombinant MsbA from Nitrosococcus oceani should be stored at -20°C in a Tris-based buffer containing 50% glycerol . For long-term storage, conservation at -20°C or -80°C is recommended . Importantly, repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity .

For ongoing experiments, working aliquots can be stored at 4°C for up to one week . This approach minimizes freeze-thaw cycles while providing convenient access to the protein for experimental procedures. When planning experiments involving MsbA, researchers should consider its stability in various detergents and buffer conditions, as these factors significantly influence both structural integrity and enzymatic activity.

What structural insights have been gained regarding the lipid A transport pathway in MsbA?

Recent structural studies have provided significant insights into the mechanism of lipid A transport by MsbA. X-ray crystallography at 2.8 Å resolution of MsbA from Salmonella typhimurium in an inward-facing conformation, co-crystallized with lipid A, has revealed critical features of the transport pathway .

The structure displays a large amplitude opening in the transmembrane portal, which researchers believe is essential for lipid A to pass from its site of synthesis into the protein-enclosed transport pathway . Electron density attributed to lipid A was observed at multiple locations: inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices . These observations support a "trap and flip" model for lipid A transport, where the substrate is first captured in the inner cavity before being flipped to the periplasmic leaflet.

Structural analysis has also revealed apparent inconsistencies between different conformational states of MsbA. The lipid A-bound structures observed in some studies appear inconsistent with the large nucleotide-binding domain (NBD) separation observed in a previous lower-resolution (5.3 Å) X-ray structure solved without lipopolysaccharide (LPS) and in detergents (PDB accession 3B5W) . This wide-open conformer represents the most extreme separation among all ABC transporter structures solved to date, and its physiological relevance continues to be debated in the field .

What experimental challenges exist in structural studies of MsbA with bound lipid substrates?

High-resolution structural determination of ABC transporters like MsbA with bound transport substrates presents significant experimental challenges. These difficulties stem from several factors:

  • Weak binding affinity: Transport substrates typically have weak binding affinity and brief residence time within the transporter .

  • Conformational flexibility: MsbA and other ABC transporters exhibit significant conformational flexibility during the transport cycle, making it difficult to capture stable states for crystallization .

  • Detergent selection: The choice of detergent critically affects both structural stability and functional activity of membrane proteins like MsbA. Recent advances have employed structurally unique amphiphiles, such as FA-3, to achieve higher resolution structures .

  • Substrate complexity: Lipid A is a complex, amphipathic molecule that presents challenges for co-crystallization experiments. Successful approaches have included the use of stabilizing amphiphiles and small molecule antagonists to capture specific conformational states .

Recent breakthroughs in structural biology have only recently enabled MsbA crystal structures beyond 3 Å resolution. These advances required innovative approaches, including the binding of potent antagonists (such as G907) along with the use of specially developed amphiphiles . The preparation of MsbA in these optimized conditions has yielded samples with preserved ATPase activity comparable to that observed in lipid nanodiscs, significantly higher than in most conventional detergents .

How do amphiphiles and detergents affect MsbA structure and function in experimental systems?

The selection of amphiphiles and detergents has profound effects on both the structural integrity and functional activity of MsbA in experimental systems. Recent studies highlight that MsbA preparations in the specially developed amphiphile FA-3 exhibited ATPase activity in the range of 6–10 μmol ATP/min/mg protein . This activity level is comparable to that determined in lipid nanodiscs and significantly higher than in most other conventional detergents .

Researchers have systematically evaluated more than 200 new detergents for crystallization of MsbA with lipid A substrate, finding that facial amphiphiles (FAs) provide superior results . These specialized detergents appear to stabilize the protein while allowing it to maintain a more native-like conformation and activity profile.

The impact of detergent choice extends beyond activity measurements to structural studies. The most wide-open conformer of MsbA (with large separation between nucleotide-binding domains) was observed in a lower-resolution structure solved using conventional detergents without lipopolysaccharide . This raises important questions about whether certain detergent environments may induce non-physiological conformations that do not accurately represent the protein's functional states in the bacterial membrane.

These findings emphasize the importance of carefully selecting membrane-mimetic environments when studying MsbA and highlight the potential for amphiphile-induced artifacts in structural and functional studies of membrane transporters.

What expression systems are optimal for producing functional recombinant MsbA?

While the search results don't provide specific information about expression systems for Nitrosococcus oceani MsbA, successful recombinant production of this protein generally follows established protocols for membrane proteins. Based on the available product information, the recombinant Nitrosococcus oceani MsbA is produced as a full-length protein (residues 1-597) .

The expression system selection should consider several factors:

  • Protein folding and membrane insertion: As MsbA is a membrane protein with multiple transmembrane segments, expression systems that support proper folding and membrane insertion are essential. E. coli-based systems with specialized strains (C41, C43) that accommodate membrane protein overexpression are commonly employed.

  • Post-translational modifications: If native glycosylation or other modifications are required, eukaryotic expression systems may be necessary.

  • Affinity tags: The product information mentions that "the tag type will be determined during production process" , suggesting flexibility in the choice of affinity tags to facilitate purification.

  • Expression conditions: Temperature, induction timing, and media composition must be optimized to balance protein yield with proper folding and function.

Functional assays, particularly ATPase activity measurements, are crucial for verifying that the expressed protein retains its native activity. As noted in the structural studies, preparations of MsbA that exhibit ATPase activity in the range of 6–10 μmol ATP/min/mg protein are considered to represent functional protein conformations .

What methods can be used to assess the lipid flippase activity of MsbA?

Assessing the lipid flippase activity of MsbA requires specialized techniques that can monitor the translocation of lipid substrates across membranes. Several methodological approaches have been documented in the literature:

  • In vivo complementation: The essential nature of MsbA can be leveraged in complementation assays, where mutant variants are tested for their ability to restore viability in conditional MsbA-deficient bacterial strains.

  • Reconstituted systems: MsbA can be reconstituted into proteoliposomes with fluorescently labeled lipid A analogues, allowing for direct measurement of transport activity through fluorescence-based assays.

  • ATPase activity coupling: Since lipid transport is coupled to ATP hydrolysis, measuring the ATPase activity of MsbA in the presence of lipid A substrates provides an indirect measure of transport function. Functional MsbA exhibits ATPase activity in the range of 6–10 μmol ATP/min/mg protein .

  • Structural approaches: As evidenced by the co-crystallization studies with lipid A, structural biology methods can provide insights into substrate binding and transport mechanisms. The observation of lipid A density at multiple positions within the MsbA structure supports the "trap and flip" model for transport .

Each of these methodological approaches offers distinct advantages and limitations. Comprehensive assessment of MsbA flippase activity typically requires a combination of these techniques to build a complete picture of the transport mechanism.

What evidence supports the "trap and flip" model for MsbA-mediated lipid transport?

The "trap and flip" model for MsbA-mediated lipid transport has gained significant experimental support from recent structural studies. This model proposes that lipid A is first captured or "trapped" in the transmembrane cavity of MsbA before being "flipped" to the periplasmic leaflet of the inner membrane.

Key evidence supporting this model includes:

  • Multilocation substrate density: X-ray crystallography at 2.8 Å resolution has revealed putative lipid A density at multiple locations within the MsbA structure - inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices . This distribution of substrate density is consistent with capturing different stages of the transport process.

  • Transmembrane portal opening: The structure displays a large amplitude opening in the transmembrane portal, which researchers propose is required for lipid A to pass from its site of synthesis into the protein-enclosed transport pathway . This entry point represents the initial "trap" phase of the model.

  • Conformational changes: Comparative analysis with existing MsbA structures suggests significant conformational rearrangements during the transport cycle, which would facilitate the "flip" component of the model .

  • Functional evidence: Biochemical studies have established MsbA as a lipid flippase that transports lipid A with or without core sugars from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane , providing functional validation of the flipping activity proposed in the model.

The "trap and flip" model represents a refinement of our understanding of ABC transporter mechanisms and emphasizes the specialized adaptations of MsbA for handling its large, amphipathic lipid substrates.

How do the structural features of MsbA from Nitrosococcus oceani compare to homologs from other bacterial species?

While the search results don't provide direct structural comparisons between MsbA from Nitrosococcus oceani and other bacterial homologs, we can analyze the available sequence and functional information to draw some comparisons.

The full amino acid sequence of Nitrosococcus oceani MsbA is provided in the search results , which enables sequence-based comparisons with homologs from other species. The protein consists of 597 amino acids and has a UniProt accession number of Q3J7R8 .

MsbA proteins across different bacterial species share several key structural features:

  • Transmembrane domains: Multiple transmembrane helices that form the substrate translocation pathway.

  • Nucleotide-binding domains (NBDs): Conserved domains that bind and hydrolyze ATP to power the transport cycle.

  • ATP-binding motifs: Highly conserved Walker A, Walker B, and signature motifs that coordinate ATP binding and hydrolysis.

Structural studies of MsbA from Salmonella typhimurium have revealed important conformational states, including an inward-facing conformation with a large amplitude opening in the transmembrane portal . The extent to which these structural features are conserved in Nitrosococcus oceani MsbA remains an open question that would require direct structural determination.

Functional conservation is suggested by the consistent classification of MsbA as a lipid A export ATP-binding/permease protein across bacterial species, with the enzyme commission number EC= 3.6.3.- indicating its role as an ATPase-coupled transporter .

How can site-directed mutagenesis be employed to investigate critical residues in MsbA function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in MsbA. By systematically altering specific amino acid residues and assessing the impact on transport activity, researchers can identify critical functional elements of the protein.

Key targets for site-directed mutagenesis in MsbA include:

  • ATP binding and hydrolysis residues: Mutations in the Walker A motif (e.g., lysine to methionine), Walker B motif (e.g., glutamate to glutamine), and signature motif can disrupt ATP binding or hydrolysis, enabling separation of these steps in the transport cycle.

  • Transmembrane domain residues: Residues lining the lipid A binding pocket and translocation pathway can be mutated to assess their role in substrate recognition and transport. The observation of lipid A density at specific locations within the MsbA structure provides guidance for selecting residues that might directly interact with the substrate .

  • Interdomain interfaces: Residues at interfaces between transmembrane domains and nucleotide-binding domains can be mutated to investigate how conformational changes are transmitted between different regions of the protein.

  • Periplasmic and cytoplasmic loops: These regions often contain functional motifs that regulate transport activity or mediate interactions with other cellular components.

Functional assessment of MsbA mutants typically involves measurement of ATPase activity, lipid transport assays, and in vivo complementation studies. Advanced approaches include structural analysis of mutant proteins to directly visualize the impact of mutations on protein conformation and substrate binding.

What is the relationship between ATP hydrolysis and lipid A transport in MsbA?

The relationship between ATP hydrolysis and lipid A transport in MsbA represents a central aspect of its function as an ABC transporter. The search results indicate that preparations of MsbA in optimized conditions exhibit ATPase activity in the range of 6–10 μmol ATP/min/mg protein , providing a baseline for functional activity.

Several key principles govern this relationship:

  • Energy coupling: ATP hydrolysis provides the energy required to power the conformational changes that drive lipid A translocation across the membrane. This coupling is a defining feature of ABC transporters like MsbA.

  • Conformational cycling: The ATP hydrolysis cycle drives transitions between different conformational states of MsbA, including inward-facing, outward-facing, and intermediate conformations. These structural changes facilitate the "trap and flip" mechanism for lipid transport .

  • Basal vs. substrate-stimulated activity: Many ABC transporters exhibit basal ATPase activity that can be stimulated by the presence of transport substrates. The extent to which lipid A stimulates MsbA ATPase activity provides insights into the coupling mechanism.

  • Cooperative behavior: The two nucleotide-binding domains of MsbA function cooperatively, with ATP binding and hydrolysis events coordinated between the two sites.

Experimental approaches to investigate this relationship include:

  • Comparing ATP hydrolysis rates in the presence and absence of lipid A

  • Using non-hydrolyzable ATP analogs to trap specific conformational states

  • Correlating ATP hydrolysis with lipid transport rates in reconstituted systems

  • Structural studies of MsbA in different nucleotide-bound states

The recent high-resolution structural studies of MsbA with bound lipid A have provided important insights into how substrate binding and transport are coordinated with the ATP hydrolysis cycle .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.