Recombinant Nitrosococcus oceani NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction

NADH-quinone oxidoreductase subunit A (NuoA) is a component of the NADH-quinone oxidoreductase (NDH-1), also known as Complex I, an enzyme found in various organisms, including the marine bacterium Nitrosococcus oceani . NDH-1 is a large, multi-subunit enzyme complex that plays a crucial role in cellular respiration by transferring electrons from NADH to quinones, coupled with the translocation of protons across the cytoplasmic membrane .

General Function and Biological Properties

NuoA is a subunit of the NDH-1 complex, which functions as an oxidoreductase, catalyzing the transfer of electrons from NADH to quinones . The NDH-1 complex uses FMN and iron-sulfur (Fe-S) centers to shuttle electrons from NADH to quinones in the respiratory chain . It is believed that ubiquinone is the immediate electron acceptor for this enzyme in N. oceani . The redox reaction is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving the redox energy in a proton gradient .

Genomic Context and Occurrence

The genome of N. oceani contains two complete, yet different, sets of genes encoding Complex I (NDH-1/NADH Quinone oxidoreductase) . One copy of Complex I is encoded by genes Noc_1115-1127, which are similar to Complex I genes found in other Gammaproteobacteria . The second set of genes encoding Complex I (Noc_2552-2565) includes genes with top hits to N. europaea, other Betaproteobacteria, and Gammaproteobacteria . The role of these distinct complexes in N. oceani is unknown; it is speculated that the complex most similar to that in N. europaea may be involved in reverse electron flow when ammonia is the sole electron donor, while the gammaproteobacterial complex may be important in forward electron flow associated with NADH oxidation . N. oceani also possesses genes to encode a Na+-transporting NADH:ubiquinone oxidoreductase (Noc_0970, Noc_1170-1174) .

Widespread Distribution of Complex I

Homologues of the 14-subunit mitochondrion-like proton-translocating NADH:quinone oxidoreductase (complex I) are widespread . A phylogenomic analysis of 1,058 representative genomes (970 bacterial and 88 archaeal) predicted the enzyme to be widespread in bacteria (predicted in 52% of analyzed genomes) and mostly absent in archaea (predicted in only one genome, Halorhabdus utahensis DMS 12940) . The genes encoding complex I (nuoA to nuoN) were colocalized in 86% of the bacterial genomes where the enzyme was found, indicating they may be part of a polycistronic operon (as is the case for Escherichia coli) .

Tables

Identification
NameNADH-quinone oxidoreductase subunit A
Synonyms
Gene NamenuoA
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on NADH or NADPH
Specific FunctionNDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain
Cellular LocationCell inner membrane; Multi-pass membrane protein
SMPDB Pathways
KEGG Pathways
KEGG Reactions
SMPDB Reactions
Complex Reactions
Metabolites
GO Classification
Gene Properties
Blattnerb2288
Gene OrientationCounterclockwise
Centisome Percentage51.78

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Noc_1127; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Target Names
nuoA
Target Protein Sequence
MQFTEFWPFILYAGMVLVLVALIVGFSYILGQRPRERATDEPFESGVVTVGFARLRFPAK FYLVAVLFVIFDMEAAFIFAWAVAFRETGWIGYGGALAFITILGVALIYEWRVGALDWQP KGRKHKKHR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This process is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy in a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrosococcus oceani and what metabolic role does NADH-quinone oxidoreductase play?

Nitrosococcus oceani (ATCC 19707) is a Gram-negative obligate chemolithoautotroph belonging to the class Gammaproteobacteria. This marine bacterium derives energy and reducing power from the oxidation of ammonia to nitrite, making it an important contributor to the global nitrogen cycle . NADH-quinone oxidoreductase (Complex I) plays a critical role in the electron transport chain of N. oceani, facilitating electron transfer between NADH and the ubiquinone pool .

In the context of chemolithoautotrophic metabolism, Complex I can operate in reverse to generate NADH needed for biosynthetic reactions using the proton motive force. This is particularly important for N. oceani, which, as an ammonia oxidizer, must generate reducing power for carbon fixation and other anabolic processes from inorganic nitrogen oxidation .

How is the genomic organization of nuoA characterized in N. oceani?

Genomic sequencing of N. oceani has revealed that this organism contains two complete yet different sets of genes encoding Complex I (NDH-1/NADH quinone oxidoreductase) . The first set of Complex I genes (Noc_1115-1127) shows highest similarity to those found in other Gammaproteobacteria . This operon contains 13 genes, with the c and d subunits fused into a single gene .

The second set of Complex I genes (Noc_2552-2565) includes genes with top BLAST hits to Nitrosomonas europaea (a Betaproteobacterium) and other Beta- and Gammaproteobacteria . The nuoA subunit is part of this complex genomic arrangement, reflecting the evolutionary history and potential functional specialization of NADH-quinone oxidoreductase in N. oceani.

What is the proposed functional differentiation between the two Complex I systems in N. oceani?

Researchers have proposed that the two distinct Complex I systems in N. oceani serve different metabolic roles . The complex showing stronger similarity to that found in Nitrosomonas europaea likely plays a role in reverse electron flow when ammonia is the sole electron donor—a critical function for a chemolithoautotroph .

In contrast, the more typical gammaproteobacterial complex may be important in forward electron flow associated with NADH oxidation . This dual system may allow N. oceani to adapt to different energy generation needs depending on available substrates and environmental conditions. The nuoA subunit, as a component of Complex I, would participate in these specialized functions, making it an interesting target for understanding energy metabolism in ammonia-oxidizing bacteria.

What expression systems are most effective for producing recombinant nuoA from N. oceani?

Based on experience with similar membrane proteins, E. coli-based expression systems using pET vectors typically provide good yields for N. oceani nuoA recombinant production. For optimal expression, consider these methodological approaches:

  • Vector Selection: pET vectors containing T7 promoters are generally recommended, with C-terminal His-tags to facilitate purification while minimizing interference with membrane insertion.

  • Expression Host Optimization: E. coli strains BL21(DE3) or C43(DE3), specially designed for membrane protein expression, typically yield better results than standard strains.

  • Induction Conditions: A temperature shift protocol (growth at 37°C to OD600 ~0.6-0.8, followed by induction with 0.1-0.5 mM IPTG at 18-20°C for 16-20 hours) often improves soluble expression of membrane-associated proteins like nuoA.

What purification strategies yield highest purity recombinant nuoA protein?

A multi-step purification approach is recommended for obtaining high-purity nuoA protein:

Table 1: Recommended Purification Protocol for Recombinant nuoA

StepMethodBuffer CompositionNotes
1Cell lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSFAddition of 700 mM NaCl reflects adaptation to marine environment of N. oceani
2Membrane fraction isolationUltracentrifugation at 100,000 × g, 1 hourResuspend membrane pellet in solubilization buffer
3Membrane protein solubilizationAbove buffer + 1% n-Dodecyl β-D-maltosideGentle overnight solubilization at 4°C
4IMAC purificationAbove buffer + 0.05% DDM and 10-250 mM imidazole gradientMonitor A280 and collect peak fractions
5Size exclusion chromatography50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol, 0.05% DDMFinal polishing step

This protocol takes into account the halophilic nature of N. oceani, which thrives in marine environments with high salt concentrations (optimally 700 mM NaCl) .

What analytical methods are most informative for characterizing recombinant nuoA?

For comprehensive characterization of recombinant nuoA protein:

  • Structural Integrity Assessment:

    • CD spectroscopy to evaluate secondary structure content

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to assess folding quality

  • Functional Analysis:

    • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

    • Electron transfer kinetics measured via stopped-flow spectroscopy

    • Reconstitution into liposomes to assess membrane insertion and activity

  • Interaction Studies:

    • Blue native PAGE to analyze complex formation

    • Crosslinking mass spectrometry to map interaction interfaces with other subunits

    • Surface plasmon resonance to quantify binding to other Complex I components

How does nuoA contribute to the sodium circuit in N. oceani and what are the implications for marine adaptation?

The genome of N. oceani contains genes encoding a Na⁺-transporting NADH:ubiquinone oxidoreductase, Na⁺-dependent V-type ATPase, and several Na⁺/H⁺ antiporters, suggesting the existence of a sodium circuit in addition to the typical proton circuit . This sodium-dependent system likely represents an adaptation to the high-salt marine environment of N. oceani.

The sodium-dependent Complex I (including nuoA) may function in reverse under chemolithotrophic conditions to generate additional NADH, while the sodium-dependent ATPase would remove excess sodium from the cytoplasm . Under mixotrophic conditions, the sodium gradient might contribute to membrane energetics in a complementary manner to the proton circuit.

Notably, this sodium circuit could effectively convert sodium-motive force into proton-motive force, potentially enhancing chemotaxis and proton-dependent transport capabilities . Studying the role of nuoA in this system provides insights into the molecular adaptations enabling energy conservation in marine ammonia-oxidizing bacteria.

What structural and functional differences exist between nuoA in the two Complex I systems of N. oceani?

While the complete details of structural differences between nuoA in the two Complex I systems are not fully characterized, comparative genomic analysis reveals several key distinctions:

Table 2: Comparative Analysis of nuoA in the Two Complex I Systems of N. oceani

FeatureComplex I System 1 (Noc_1115-1127)Complex I System 2 (Noc_2552-2565)
Evolutionary originGammaproteobacterial lineageMixed Beta/Gammaproteobacterial lineage
Proposed primary functionForward electron transport (NADH oxidation)Reverse electron transport (NADH generation)
Operon structure13 genes (c and d subunits fused)14 genes (standard arrangement)
Expression pattern hypothesisPotentially upregulated under organotrophic conditionsLikely constitutive under ammonia oxidation

These differences suggest functional specialization that may be reflected in subtle structural variations in the nuoA subunit between the two complexes. Site-directed mutagenesis and chimeric protein construction studies would be valuable approaches to elucidate these differences.

How does the function of nuoA in N. oceani compare to homologous proteins in other ammonia-oxidizing bacteria?

Complex I is central to energy metabolism in ammonia-oxidizing bacteria (AOB), but its configuration and role differ between gamma- and betaproteobacterial AOB. In N. oceani (a gamma-AOB), Complex I appears to have dual functionality with two distinct systems , whereas in betaproteobacterial AOB like Nitrosomonas europaea, a single Complex I system operates primarily in reverse.

The presence of two Complex I systems in N. oceani, one with greater similarity to betaproteobacterial AOB, suggests that nuoA and other Complex I components have evolved distinct properties to function effectively in reverse electron transport. Comparative analysis of nuoA across AOB reveals adaptations potentially reflecting the different ecological niches these organisms occupy—marine environments for N. oceani versus soil and freshwater for many betaproteobacterial AOB.

What kinetic parameters are most relevant when studying nuoA function, and how should they be determined?

When studying nuoA function within Complex I, several kinetic parameters are particularly informative:

Table 3: Key Kinetic Parameters for nuoA Functional Analysis

For robust kinetic analysis, it's essential to use purified protein reconstituted in a membrane-like environment or membrane preparations with defined Complex I content. Temperature and pH should be carefully controlled to reflect the optimal growth conditions of N. oceani (pH 7.5-8.0, 28-37°C) .

What approaches are recommended for investigating the interaction between nuoA and other subunits of Complex I?

Investigating subunit interactions within Complex I requires multiple complementary approaches:

  • Crosslinking-Mass Spectrometry (XL-MS):

    • Chemical crosslinkers with different spacer arm lengths can capture interactions

    • MS/MS analysis identifies crosslinked peptides, revealing proximity relationships

    • Data analysis requires specialized software (e.g., StavroX, MeroX) to identify crosslinked peptides

  • Cryo-EM Structural Analysis:

    • Recent advances make it feasible to determine structures of membrane protein complexes

    • Sample preparation critical: detergent selection, protein concentration, and grid preparation

    • Compare structures with and without substrates/inhibitors to capture conformational changes

  • Genetic Approaches:

    • Site-directed mutagenesis of predicted interface residues

    • Suppressor mutation analysis to identify compensatory changes

    • BN-PAGE analysis of complex assembly with mutant subunits

How should researchers address contradictory results when studying recombinant nuoA?

When faced with contradictory results in nuoA research, consider these methodological approaches:

  • Systematic Variation of Experimental Conditions:

    • Test activity across a range of pH values (7.0-8.5) and salt concentrations (300-800 mM NaCl)

    • Consider temperature effects (25-40°C) on protein stability and activity

    • Evaluate the impact of different detergents on protein conformation and function

  • Control Experiments:

    • Include positive controls with known Complex I activity

    • Perform parallel experiments with closely related proteins (e.g., nuoA from N. halophilus)

    • Use multiple independent protein preparations to rule out batch-specific artifacts

  • Complementary Techniques:

    • If in vitro assays yield contradictory results, consider in vivo approaches

    • Combine biochemical, biophysical, and computational methods

    • Consider whether the two different Complex I systems might explain divergent results

  • Statistical Analysis:

    • Use appropriate statistical tests to determine significance

    • Perform power analysis to ensure adequate sample size

    • Consider Bayesian approaches for integrating disparate data sets

What are the most promising approaches for studying the differential expression of the two Complex I systems in N. oceani?

Understanding the differential expression of the two Complex I systems requires multi-faceted approaches:

  • Transcriptomic Analysis:

    • RNA-Seq under various growth conditions (varying ammonia concentrations, presence/absence of organic carbon)

    • qRT-PCR validation of expression patterns for nuoA and other subunits from both complexes

    • Time-course studies during growth phase transitions

  • Proteomics Approaches:

    • Quantitative proteomics (SILAC or TMT labeling) to measure absolute protein levels

    • Membrane enrichment followed by targeted MS/MS to improve detection of low-abundance membrane proteins

    • Phosphoproteomics to identify potential regulatory modifications

  • Reporter Systems:

    • Construction of transcriptional fusions with fluorescent proteins

    • Single-cell analysis to detect potential heterogeneity in expression

    • Promoter dissection to identify regulatory elements controlling expression

These approaches could reveal the environmental and metabolic cues that trigger expression of each Complex I system, providing insights into the functional specialization of these complexes in N. oceani.

How might nuoA function contribute to N. oceani's adaptation to varying environmental conditions?

The dual Complex I systems in N. oceani, of which nuoA is a component, likely provide metabolic flexibility in response to environmental changes. Research indicates that N. oceani is adapted to marine environments with optimal growth at 700 mM NaCl, pH 7.5-8.0, and temperatures around 37°C . The sodium-dependent bioenergetic components, potentially including one of the Complex I systems, may be particularly important for adaptation to varying salinity levels in marine and coastal environments.

Future research should explore how the expression and activity of nuoA-containing complexes respond to environmental stressors such as:

  • Fluctuations in ammonia availability

  • Varying oxygen concentrations

  • pH changes in increasingly acidified oceans

  • Temperature variations due to climate change

  • Presence of organic carbon sources that might enable mixotrophic growth

Understanding these adaptations could provide insights into the ecological role of N. oceani in marine nitrogen cycling and its response to changing oceanic conditions.

What potential biotechnological applications might emerge from research on N. oceani nuoA?

Research on the dual Complex I systems of N. oceani, including nuoA, could lead to several biotechnological applications:

  • Bioenergetic Engineering:

    • Development of optimized electron transport chains for biotechnological processes

    • Engineering of salt-tolerant biocatalysts for industrial applications

    • Creation of biosensors for monitoring marine environmental conditions

  • Bioremediation Applications:

    • Enhancement of nitrogen removal in saline wastewater treatment

    • Design of specialized bioreactors for ammonia oxidation in high-salt environments

    • Development of biocatalysts for industrial ammonia transformation

  • Structural Biology Insights:

    • Understanding sodium-dependent bioenergetics could inform design of novel ion pumps

    • Structural features of salt-adapted proteins could guide protein engineering for harsh conditions

    • Mechanisms of ion selectivity could inform development of selective ion channels or transporters

These applications reflect the potential to translate fundamental research on nuoA and related proteins into biotechnological innovations addressing environmental and industrial challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.