Recombinant Nitrosococcus oceani NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Nitrosococcus oceani Metabolism

In N. oceani, nuoK is part of two distinct Complex I operons:

  1. Forward Electron Transport: A Gammaproteobacteria-like operon (Noc_1115–1127) involved in NADH oxidation and proton pumping .

  2. Reverse Electron Transport: A Betaproteobacteria-like operon (Noc_2552–2565) critical for generating NADH from quinol during ammonia oxidation .

Key Research Findings:

  • Reverse Electron Flow: The Betaproteobacteria-like Complex I (including nuoK) enables NADH production for carbon fixation in autotrophic growth, a process powered by ammonia oxidation .

  • Sodium-Dependent Activity: Genomic evidence suggests a Na⁺-translocating Complex I (Noc_0970, 1170–1174) that interacts with nuoK in energy metabolism, potentially aiding Na⁺ efflux in high-salt environments .

  • Gene Expression: Transcriptional studies reveal upregulation of nuoK-related genes under ammonium-rich conditions, aligning with its role in redox balancing .

Comparative Genomic Insights

The N. oceani genome encodes two Complex I operons, a feature absent in most Betaproteobacteria. Phylogenomic analyses highlight:

FeatureN. oceaniOther BacteriaSources
Complex I IsozymesTwo operons (gamma- and beta-like)Typically one operon
Proton vs. Sodium MotiveBoth H⁺- and Na⁺-dependent Complex IH⁺-dependent in most bacteria
Electron FlowReverse (NADH generation) and forward (NADH oxidation)Primarily forward

This dual system allows N. oceani to adapt to energy-limited marine environments by optimizing electron transfer efficiency .

Research Applications and Challenges

Recombinant nuoK serves as a model for studying:

  • Electron Transfer Mechanisms: Structural analysis of quinone-binding regions and proton-pumping domains.

  • Metabolic Adaptation: Role in ammonia oxidation and carbon fixation in autotrophs.

  • Biotechnological Potential: Engineering Complex I variants for bioenergy applications.

Challenges include resolving the structural dynamics of nuoK within the oligomeric Complex I and elucidating its interactions with other subunits (e.g., NuoA, NuoB) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Noc_1118; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Target Names
nuoK
Target Protein Sequence
MLASIPTEHGLYLAAALFILGLIGVLVRRNLIFMLLSLEIMLNATGLAFIVAGARWGEAE GQIMFMLILTLAAAEAAVALALILLVYRRFGTLDADRLSRMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoK in Nitrosococcus oceani?

NuoK is one of the subunits of NADH-quinone oxidoreductase (Complex I) encoded in the Nitrosococcus oceani genome. The complete genome sequencing of N. oceani ATCC 19707 revealed that this organism contains a single circular chromosome (3,481,691 bp; 50.4% G+C) and a plasmid (40,420 bp) . The genome analysis showed that N. oceani contains two complete copies of the genes necessary to assemble functional Complex I, including the nuoK subunit . This duplication suggests the importance of maintaining robust electron transport capabilities for this chemolithoautotrophic bacterium that derives its energy from ammonia oxidation.

Why is nuoK of particular interest for recombinant studies compared to other Complex I subunits?

NuoK represents one of the smaller, hydrophobic subunits of Complex I and is believed to be involved in proton translocation across the membrane. Its compact size makes it amenable to recombinant expression studies, while its integral membrane nature presents interesting challenges for structural analysis. Unlike some of the larger subunits, nuoK's relatively small size allows for more efficient expression in heterologous systems. Additionally, N. oceani's adaptation to marine environments may confer unique properties to its nuoK subunit compared to those from other organisms, potentially offering insights into the evolution of energy metabolism in specialized niches.

What are the optimal primer design considerations for cloning N. oceani nuoK?

When designing primers for N. oceani nuoK amplification, researchers should consider the following parameters:

  • Base composition: Account for the relatively high G+C content (50.4%) of the N. oceani genome to optimize annealing temperatures .

  • Codon optimization: While N. oceani has a distinct codon usage pattern, the nuoK sequence may require optimization for expression in common host systems such as E. coli.

  • Addition of restriction sites: Include appropriate restriction sites that are absent in the nuoK sequence but present in your expression vector.

  • Fusion tags: Consider incorporating sequences for affinity tags (His, GST, etc.) to facilitate purification, while being mindful that membrane proteins may have altered topology with N-terminal tags.

Sample primer design approach:
Forward primer: 5'-[Restriction site]-[Kozak sequence if eukaryotic]-[Start codon]-[18-25 bp of nuoK 5' sequence]-3'
Reverse primer: 5'-[Restriction site]-[Stop codon or tag sequence]-[18-25 bp of complementary nuoK 3' sequence]-3'

What expression systems are most effective for recombinant nuoK production?

For recombinant expression of membrane proteins like nuoK, consider these systems with their respective advantages:

Expression SystemAdvantagesConsiderations for nuoK
E. coli BL21(DE3)Rapid growth, high yield, economicalMay require specialized vectors (pET, pBAD) with tunable expression; codon optimization may be necessary
E. coli C41/C43Specifically engineered for membrane proteinsReduced toxicity during overexpression; better for maintaining protein folding
Yeast (P. pastoris)Eukaryotic folding machinery, capable of scale-upLonger expression time but potentially better folding of complex membrane proteins
Cell-free systemsAvoids toxicity, direct incorporation of detergents/lipidsExpensive but allows precise control over expression environment

Successful expression typically requires testing multiple conditions, including varying induction parameters (temperature, inducer concentration, time) and incorporating molecular chaperones to aid proper folding of this integral membrane protein.

How can the solubility and stability of recombinant nuoK be optimized during purification?

Optimizing solubility and stability of recombinant nuoK requires careful consideration of detergents and buffer conditions:

  • Detergent screening: Test a panel of detergents including mild non-ionic detergents (DDM, LMNG), zwitterionic detergents (LDAO, FC-12), and newer amphipols or nanodiscs for improved stability.

  • Buffer optimization: Include components that mimic the native environment of N. oceani:

    • Slightly alkaline pH (7.5-8.0)

    • Moderate salt concentration (200-500 mM NaCl) reflecting marine conditions

    • Addition of glycerol (10-20%) as a stabilizing agent

  • Inclusion of specific lipids: E. coli lipids or synthetic lipids to maintain native-like environment

  • Antioxidants: Addition of reducing agents (DTT, β-mercaptoethanol) to prevent oxidation of cysteine residues

Purification should employ a gradual approach, beginning with gentle solubilization from the membrane fraction, followed by affinity chromatography, and additional polishing steps while consistently maintaining the optimized detergent/buffer conditions.

What techniques are most informative for determining the structure of nuoK in isolation versus within Complex I?

The structural analysis of nuoK presents different challenges depending on whether it's studied in isolation or as part of the complete Complex I. The following methods offer complementary insights:

TechniqueApplication to Isolated nuoKApplication to Complete Complex I
X-ray CrystallographyChallenging due to small size and hydrophobicity; requires detergent screening or LCPProvides high-resolution structure of entire complex; multiple structures of bacterial Complex I exist as templates
Cryo-EMGenerally difficult for small membrane proteins (<50 kDa)Increasingly the method of choice for large membrane complexes; can resolve subunit interactions
NMR SpectroscopySuitable for determining structure and dynamics of this smaller membrane protein in micelles or nanodiscsLimited to specific labeled regions within the complex
Molecular DynamicsComplements experimental approaches; models membrane interactionsSimulates proton pathways and conformational changes during catalysis

For nuoK specifically, researchers often use a hybrid approach: obtaining experimental constraints from biochemical and spectroscopic methods, then integrating these with computational modeling based on homologous structures from related organisms.

How can researchers assess the functional integrity of recombinant nuoK?

Assessing the functional integrity of recombinant nuoK involves several complementary approaches:

  • Complex I activity reconstitution: Incorporating purified nuoK into nuoK-depleted Complex I and measuring restoration of NADH:ubiquinone oxidoreductase activity.

  • Proton translocation assays: Using pH-sensitive fluorescent probes (ACMA, pyranine) to detect proton movement in proteoliposomes containing reconstituted nuoK or nuoK-containing subcomplexes.

  • Binding assays: Measuring interaction with other Complex I subunits using techniques like microscale thermophoresis or surface plasmon resonance.

  • EPR spectroscopy: Detecting changes in the local environment of strategically introduced spin labels to monitor conformational changes.

  • Complementation studies: Expressing recombinant N. oceani nuoK in nuoK-deficient bacterial strains to assess functional rescue.

It's important to note that functional assessment of individual Complex I subunits is challenging, and often requires reconstitution with partner subunits to observe meaningful activity.

What are the critical amino acid residues in nuoK that differentiate N. oceani from other bacterial species?

While the search results don't provide specific sequence information about N. oceani nuoK, comparative analysis of nuoK sequences across species typically reveals several categories of differentiating residues:

  • Proton translocation pathway residues: Conserved charged amino acids (Glu, Asp, Lys, His) that participate in proton transfer.

  • Interface residues: Amino acids involved in interactions with adjacent subunits (particularly nuoJ and nuoL).

  • Lipid-binding sites: Residues that interact with specific lipids, potentially differing in marine bacteria.

  • N-terminal region: Often shows higher variability and may contain species-specific regulatory elements.

A detailed multiple sequence alignment of nuoK from N. oceani against other marine and non-marine bacteria would identify specific residues that might contribute to adaptation to the marine environment, including salt tolerance and functioning at various ocean depths and temperatures.

How does nuoK contribute to the electron transport chain in N. oceani?

The nuoK subunit plays a critical role in N. oceani's electron transport chain as part of Complex I (NADH-quinone oxidoreductase). In N. oceani, the electron transport system is particularly important as it links ammonia oxidation to energy conservation . The genome analysis reveals complete sets of genes for electron transfer from NADH to O2 via NADH quinone oxidoreductase (Complex I) .

NuoK, as an integral membrane subunit, is proposed to participate in:

  • Forming part of the proton translocation channel within the membrane domain of Complex I

  • Contributing to the conformational changes that couple electron transfer to proton pumping

  • Maintaining the structural integrity of the membrane arm of Complex I

In the context of N. oceani's energy metabolism, electrons from hydroxylamine oxidation are transferred via cytochromes to the quinone pool , which can then interact with Complex I during reverse electron transport to generate reducing power (NADH) needed for carbon fixation and other biosynthetic processes.

What experimental approaches can distinguish between the roles of the two copies of nuoK found in N. oceani?

The presence of two copies of the genes necessary to assemble functional Complex I in N. oceani raises intriguing questions about potential differential roles. To distinguish between them, researchers can employ:

  • Differential expression analysis:

    • RT-qPCR to quantify expression levels under various growth conditions

    • Proteomics to determine protein abundance of each variant

    • Reporter gene fusions to monitor promoter activity

  • Genetic manipulation approaches:

    • Targeted gene knockout of individual nuoK copies

    • Complementation studies with each copy in knockout strains

    • Site-directed mutagenesis of distinguishing residues

  • Biochemical characterization:

    • Isolation of distinct Complex I populations

    • Activity measurements under varying conditions (pH, salt, temperature)

    • Subunit-specific antibody generation to track localization

  • Biophysical analysis:

    • Structural studies of purified variants

    • EPR or other spectroscopic methods to detect subtle differences in electron transfer properties

The data from these approaches can be integrated into a comprehensive model of how N. oceani might utilize different Complex I variants under different environmental conditions or metabolic states.

How can recombinant nuoK be used to study N. oceani's adaptation to different marine environments?

Recombinant nuoK provides a valuable tool for investigating N. oceani's adaptation to diverse marine conditions:

  • Site-directed mutagenesis studies:

    • Introducing mutations that mimic sequence variations found in N. oceani strains from different ocean regions

    • Testing the functional consequences under varying salinity, temperature, and pressure conditions

  • Chimeric protein analysis:

    • Creating hybrid nuoK proteins with domains from N. oceani strains isolated from different marine environments

    • Assessing functional properties to identify key adaptive regions

  • In vitro evolution experiments:

    • Subjecting recombinant nuoK to directed evolution under conditions mimicking specific marine niches

    • Sequencing evolved variants to identify adaptive mutations

  • Comparative activity profiling:

    • Measuring activity of recombinant nuoK under conditions representing different ocean depths, temperatures, and chemical compositions

    • Correlating functional parameters with environmental conditions

These approaches allow researchers to connect the worldwide distribution of N. oceani with specific molecular adaptations in its energy metabolism components, including nuoK.

What insights can comparative studies between N. oceani nuoK and homologs from other ammonia-oxidizing bacteria provide?

Comparative studies offer valuable evolutionary and functional insights:

Comparison GroupKey QuestionsMethodological Approaches
Beta vs. Gamma AOBDoes nuoK differ between N. oceani (γ-proteobacteria) and Nitrosomonas (β-proteobacteria)?Sequence analysis, structural modeling, functional complementation
Marine vs. FreshwaterHow has nuoK adapted to marine conditions compared to freshwater nitrifiers?Activity assays under varying salt conditions, structural stability comparisons
Obligate vs. FacultativeAre there nuoK adaptations specific to obligate chemolithoautotrophs vs. facultative organisms?Analysis of energy coupling efficiency, regulatory differences
N. oceani vs. N. halophilusWhat differences explain the higher salt requirements of N. halophilus?Comparative biochemistry, salt tolerance tests with recombinant proteins

Such comparative studies would build upon our understanding of the worldwide distribution patterns of these organisms and their ecological adaptations, potentially revealing how energy metabolism components have evolved for specific environmental niches.

How can structural information about nuoK inform the development of inhibitors targeting pathogenic bacteria with similar Complex I components?

Structural information about nuoK can guide inhibitor development through:

  • Structure-based drug design:

    • Identification of druggable pockets within nuoK or at interfaces with other subunits

    • Virtual screening against these sites to identify potential inhibitors

    • Optimization of hits through iterative design-synthesis-testing cycles

  • Selectivity analysis:

    • Comparison of nuoK structures between target pathogens and beneficial bacteria

    • Identification of unique structural features that can be exploited for selective targeting

    • Differential binding studies of candidate inhibitors

  • Mechanism-based approaches:

    • Elucidation of proton translocation pathways through nuoK

    • Design of molecules that specifically disrupt critical proton transfer steps

    • Development of transition-state analogs that interfere with conformational changes

  • Resistance prediction:

    • Analysis of natural sequence variations in nuoK across bacterial species

    • Identification of potential resistance mutations

    • Design of inhibitor scaffolds less susceptible to resistance development

While N. oceani itself is not pathogenic, the insights gained from studying its nuoK can inform broader antimicrobial strategies targeting energy metabolism in related pathogenic species.

What are the primary challenges in expressing functional recombinant N. oceani nuoK, and how can they be overcome?

Expression of functional recombinant nuoK faces several key challenges:

  • Membrane protein solubility issues:

    • Solution: Use specialized expression vectors with tunable promoters to prevent aggregation

    • Solution: Co-express with chaperones (GroEL/ES, DnaK/J) to aid proper folding

    • Solution: Express as fusion with solubility enhancers (MBP, SUMO) with cleavable linkers

  • Toxic effects on host cells:

    • Solution: Use C41/C43 E. coli strains specifically designed for membrane protein expression

    • Solution: Employ tight expression control with glucose repression or lower inducer concentrations

    • Solution: Consider cell-free expression systems to bypass toxicity issues

  • Proper membrane insertion:

    • Solution: Include appropriate signal sequences for targeting to the membrane

    • Solution: Consider using homologous expression systems from related bacteria

    • Solution: Optimize growth temperature (often lower temperatures improve folding)

  • Functional assessment:

    • Solution: Co-express with interacting partners from Complex I

    • Solution: Develop specialized activity assays for the isolated subunit

    • Solution: Use conformation-sensitive probes to monitor proper folding

How can researchers troubleshoot issues with nuoK stability during purification and structural studies?

Troubleshooting nuoK stability requires systematic approaches:

  • Detergent screening:

    • Issue: Protein aggregation or denaturation in initial detergent

    • Solution: Perform systematic detergent screen (start with DDM, LMNG, digitonin)

    • Solution: Consider newer amphipathic polymers (amphipols, SMALPs) that may better preserve native structure

  • Lipid environment:

    • Issue: Loss of essential lipid interactions during purification

    • Solution: Add specific lipids (cardiolipin, PE, PG) during purification steps

    • Solution: Consider nanodisc reconstitution with defined lipid composition

  • Oxidative damage:

    • Issue: Cysteine oxidation leading to aggregation

    • Solution: Include reducing agents throughout purification

    • Solution: Consider anaerobic purification for highly sensitive preparations

  • Temperature sensitivity:

    • Issue: Thermal denaturation during handling

    • Solution: Perform all steps at 4°C and minimize time between purification stages

    • Solution: Add stabilizing agents (glycerol, sucrose, specific ions)

  • Tracking stability:

    • Method: Use fluorescence-based thermal shift assays to quantitatively assess stability

    • Method: Size exclusion chromatography with multi-angle light scattering to monitor oligomeric state

    • Method: Limited proteolysis to identify stable domains

What data quality and validation standards should researchers apply when publishing studies on recombinant nuoK?

High-quality research on recombinant nuoK should meet these validation standards:

  • Expression and purification validation:

    • SDS-PAGE showing band of expected molecular weight

    • Western blot with antibodies against protein tag or nuoK itself

    • Mass spectrometry confirmation of protein identity

    • Size exclusion chromatography showing monodisperse behavior

  • Functional validation:

    • Activity assays with clear controls (including inactive mutants)

    • Complementation of knockout strains

    • Binding studies with interaction partners

    • Comparative analysis with native Complex I

  • Structural characterization:

    • Circular dichroism to confirm secondary structure content

    • Validation against known structural features of homologous proteins

    • Resolution statistics for crystallography or cryo-EM studies

    • NMR validation metrics including chemical shift analysis

  • Reproducibility metrics:

    • Statistical analysis of replicate experiments

    • Testing under multiple conditions

    • Independent validation using complementary techniques

    • Clear description of all methods for reproducibility

  • Data deposition:

    • Sequences submitted to GenBank

    • Structures deposited in PDB

    • Mass spectrometry data in appropriate repositories

    • Raw data availability statement

How might research on N. oceani nuoK contribute to our understanding of bioenergetics in marine environments?

Research on N. oceani nuoK opens several promising avenues for understanding marine bioenergetics:

  • Adaptation mechanisms:

    • Investigation of how nuoK structure-function relationships reflect adaptation to varying ocean conditions

    • Comparative analysis across depth gradients to understand pressure adaptations

    • Study of temperature adaptations relevant to different oceanic regions

  • Ecological significance:

    • Exploration of how nuoK efficiency contributes to N. oceani's worldwide distribution

    • Analysis of energy conservation strategies in nutrient-limited marine environments

    • Understanding competitive advantages conferred by nuoK variants

  • Evolutionary perspectives:

    • Tracing the evolution of Complex I in marine bacteria versus terrestrial bacteria

    • Investigating horizontal gene transfer of bioenergetic components in marine ecosystems

    • Comparative genomics across marine nitrifiers to understand specialized adaptations

  • Biogeochemical implications:

    • Connecting nuoK efficiency to nitrification rates in various ocean regions

    • Modeling how nuoK variants might affect nitrogen cycling under changing ocean conditions

    • Understanding the role of energy conservation in determining N2O production rates during nitrification

What potential biotechnological applications exist for engineered variants of N. oceani nuoK?

Engineered nuoK variants offer several biotechnological possibilities:

  • Bioenergy applications:

    • Development of salt-tolerant biofuel cells using robust marine-derived electron transport components

    • Engineering of enhanced electron transfer systems for microbial fuel cells

    • Creation of hybrid energy conversion systems combining features from different organisms

  • Biosensors:

    • Design of nuoK-based biosensors for detecting marine pollutants affecting bioenergetics

    • Development of whole-cell biosensors using nuoK fusions to reporter proteins

    • Creation of systems for monitoring ocean acidification effects on bioenergetic proteins

  • Synthetic biology platforms:

    • Incorporation of salt-tolerant electron transport components into synthetic organisms

    • Design of minimal energy-generating modules based on nuoK and essential partners

    • Engineering of stress-resistant energy production systems for industrial applications

  • Environmental biotechnology:

    • Development of enhanced nitrification systems for marine aquaculture

    • Engineering of organisms with improved energy efficiency for bioremediation in marine environments

    • Creation of robust biocatalysts for nitrogen transformation processes

How might climate change impact the functional efficiency of nuoK in natural populations of N. oceani?

Climate change could affect nuoK function through multiple mechanisms:

  • Temperature effects:

    • Direct impacts on protein stability and conformational dynamics

    • Changes in membrane fluidity affecting nuoK's membrane environment

    • Altered expression patterns of different nuoK variants under warming conditions

  • Ocean acidification:

    • Changes in proton gradients potentially affecting the proton-pumping function of Complex I

    • Altered protein-protein interactions within Complex I due to pH changes

    • Modified regulatory mechanisms controlling nuoK expression

  • Oxygen availability:

    • Impacts of expanding oxygen minimum zones on the electron transport chain function

    • Shifts in the balance between forward and reverse electron transport through Complex I

    • Potential adaptations in nuoK to function under variable oxygen tensions

  • Experimental approaches to study these effects:

    • Laboratory evolution studies under projected future ocean conditions

    • Comparative metagenomic analysis of nuoK sequences across oceanic gradients

    • Biochemical characterization of nuoK function under simulated future conditions

    • Molecular dynamics simulations predicting structural adaptations to changing conditions

These studies would build upon our understanding of N. oceani's worldwide distribution and how this distribution might change with evolving ocean conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.