Recombinant Nitrosomonas europaea ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requests. Please indicate your preference in the order notes for us to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development according to your requirement.
Synonyms
atpB; NE0200; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
atpB
Target Protein Sequence
MSSEAELNPTTYIQHHLTNHTISVGDGAFWVLHTDTLFMSVLLGVVSLGLIWMVVRKATS GVPSKTQAFVELLIEFIDDQVKTTFHGNRHAFVAPAALTIFVWVLLLNAMDFLPIDIMAW IYEHIFGLHNWRSVPTADVNTTFALALSIWILTIYFAIKVKGFGGWVTELVCTPFGKNPL LWPFNLLLNVIEYISKPLSHSLRLFGNMYAGEIIFMLLGMWAATGVTGTFFGAILGAGWA IFHILIVVLQAFIFMMLAVVYLSMAHESH
Uniprot No.

Target Background

Function
As a key component of the proton channel, it plays a crucial role in the transmembrane proton translocation process.
Database Links

KEGG: neu:NE0200

STRING: 228410.NE0200

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Nitrosomonas europaea metabolism?

ATP synthase in N. europaea plays a critical role in energy production during chemolithoautotrophic growth. As N. europaea oxidizes ammonia to nitrite through the successive action of ammonia monooxygenase (AMO) and hydroxylamine oxidoreductase (HAO), electrons are generated. Some of these electrons return to the AMO reaction, while others are directed toward a terminal electron acceptor . The process establishes a proton gradient across the membrane that is utilized by ATP synthase to generate ATP. The atpB subunit is integral to the membrane-embedded Fo portion of ATP synthase, forming part of the proton channel through which protons flow to drive ATP synthesis.

How does the structure of N. europaea atpB compare to that of other bacterial species?

The atpB gene in N. europaea encodes subunit a of the ATP synthase complex, which participates in forming the proton channel. While specific structural details of N. europaea atpB are not directly addressed in the available literature, it likely shares conserved features with other bacterial ATP synthase a subunits, including multiple transmembrane helices. Given that N. europaea derives all its energy from ammonia oxidation , its ATP synthase may have specific adaptations to function optimally under chemolithoautotrophic conditions compared to heterotrophic bacteria.

What expression systems are most effective for producing recombinant N. europaea atpB?

For successful expression of recombinant N. europaea atpB, E. coli-based expression systems are typically employed with modifications to accommodate the expression of membrane proteins. Key considerations include:

  • Using E. coli strains optimized for membrane protein expression (C41, C43)

  • Employing vectors with tunable promoters (like pET or pBAD systems)

  • Including fusion tags that aid in protein solubility and purification

  • Optimizing growth temperature (typically lower temperatures around 18-25°C)

  • Supplementing growth media with specific ions, particularly iron, given N. europaea's extensive iron acquisition systems

How does energy coupling differ in ATP synthase of obligate chemolithotrophs like N. europaea compared to heterotrophs?

The energy coupling mechanism in N. europaea ATP synthase may be specialized for the unique energy landscape of an obligate chemolithoautotroph. N. europaea generates energy exclusively through the oxidation of ammonia to nitrite, producing a proton gradient that drives ATP synthesis . This specialized metabolism may impose unique constraints on ATP synthase function:

  • Regulation sensitivity: N. europaea ATP synthase likely operates under narrower energetic conditions compared to heterotrophs with diverse metabolic options

  • Coupling efficiency: The enzyme may show adaptations for optimal performance under the specific proton motive force generated by ammonia oxidation

  • Redox interaction: Given the central role of electron transport in energy generation, N. europaea ATP synthase might display specialized interactions with the electron transport chain components

Research examining these aspects could employ comparative biochemical analysis of ATP synthase activity under varying pH and redox conditions, as well as structural studies to identify unique features in the proton channel formed partly by atpB.

What are the challenges in purifying functional recombinant N. europaea atpB, and how can they be overcome?

Purification of functional recombinant atpB presents several challenges:

ChallengePotential SolutionRationale
Membrane protein solubilityScreen multiple detergents (DDM, LMNG, etc.)Different detergents vary in ability to maintain protein structure
Maintaining proper foldingCo-expression with chaperonesMay improve folding of complex membrane proteins
Low expression levelsUse C-terminal fusion tags (GFP)Allows monitoring of expression and aids in optimization
Protein stabilityAddition of lipids during purificationMimics native membrane environment
Functional assessmentReconstitution into liposomesEnables functional assays in a membrane-like environment

For N. europaea atpB specifically, the purification protocol should account for the bacterial adaptation to ammonia-rich environments and should consider the complex membrane composition of this chemolithoautotroph. Inclusion of appropriate ions, particularly iron, may be important given N. europaea's extensive iron acquisition systems identified in its genome .

How do mutations in the atpB gene affect the bioenergetics and ammonia oxidation capacity of N. europaea?

Mutations in atpB would likely have profound effects on N. europaea bioenergetics, potentially altering:

  • Proton translocation efficiency, directly affecting ATP synthesis rates

  • Energy coupling between ammonia oxidation and ATP generation

  • Growth yield per mol of ammonia oxidized

  • Ability to maintain homeostasis under varying ammonium concentrations

Experimental approaches to study these effects might include:

  • Site-directed mutagenesis of conserved residues in atpB

  • Complementation studies in atpB-deficient strains

  • Measurement of proton translocation, ATP synthesis rates, and ammonia oxidation rates in mutant strains

  • Transcriptomic analysis to identify compensatory responses, similar to approaches used in the nirK mutant studies

The research should consider that, as an obligate chemolithoautotroph, N. europaea has limited metabolic flexibility, meaning that ATP synthase impairment would have particularly severe consequences compared to heterotrophs with alternative energy generation pathways.

What protocols are most effective for assessing the function of recombinant N. europaea atpB in vitro?

Effective functional assessment of recombinant N. europaea atpB requires protocols that address both its incorporation into the ATP synthase complex and its specific role in proton translocation:

  • Reconstitution assays:

    • Reconstitution of purified atpB with other ATP synthase subunits in liposomes

    • Measurement of ATP synthesis driven by artificially generated proton gradients

    • Assessment of proton transport using pH-sensitive fluorescent dyes

  • Binding and assembly studies:

    • Blue Native PAGE to assess complex assembly

    • Crosslinking studies to determine interactions with other subunits

    • Isothermal titration calorimetry to measure binding to other Fo components

  • Structural integrity analysis:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to examine folding quality

    • Thermal shift assays to evaluate stability

The protocols should be adapted to the specific ionic conditions relevant to N. europaea, particularly considering its inorganic ion transporters and limited organic transporters as identified in its genome sequence .

How can researchers optimize heterologous expression systems to improve yield and activity of recombinant N. europaea atpB?

Optimization strategies should consider the unique characteristics of N. europaea as an obligate chemolithoautotroph:

Optimization ParameterApproachExpected Outcome
Codon optimizationAdjust codons based on N. europaea preferencesImproved translation efficiency
Expression temperatureTest range from 16-30°CBalance between expression and proper folding
Membrane mimeticsScreen detergents and lipidsImproved stability and function
Induction conditionsOptimize inducer concentration and timingControl expression rate for proper folding
Fusion partnersTest various solubility/stability tagsEnhanced protein production and purification
Growth media compositionSupplement with ions essential for N. europaeaImproved protein stability
Co-expressionInclude other ATP synthase subunitsPotential stabilization through complex formation

N. europaea has adapted to derive all its energy from ammonia oxidation and has specific adaptations for iron acquisition with more than 20 genes dedicated to iron receptors . These adaptations might influence the optimal conditions for recombinant expression of its membrane proteins, including atpB.

What methods are appropriate for studying the interaction between N. europaea atpB and other ATP synthase subunits?

For investigating subunit interactions within the ATP synthase complex:

  • Co-immunoprecipitation studies:

    • Using antibodies against atpB or fusion tags

    • Mass spectrometry analysis of co-precipitated proteins

  • FRET or BRET analysis:

    • Fusion of fluorescent protein pairs to atpB and other subunits

    • Measurement of energy transfer as indication of physical proximity

  • Crosslinking experiments:

    • Chemical crosslinking followed by mass spectrometry

    • Site-specific crosslinking at engineered cysteine residues

  • Two-hybrid systems adapted for membrane proteins:

    • MYTH (Membrane Yeast Two-Hybrid)

    • Split-ubiquitin assays

  • Cryo-EM structural studies:

    • Analysis of assembled ATP synthase complexes

    • Visualization of atpB within the context of the complete enzyme

These approaches should be designed with consideration of the unique energetics of N. europaea, where ATP synthesis is exclusively dependent on the proton gradient established by ammonia oxidation .

How should researchers interpret differences in ATP synthase activity between native and recombinant N. europaea atpB?

When comparing native and recombinant atpB activity, researchers should consider multiple factors:

  • Structural differences:

    • Post-translational modifications present in native but not recombinant protein

    • Potential differences in lipid environment affecting conformation

  • Functional context:

    • Native atpB functions within the complete cellular context of N. europaea

    • Recombinant protein may lack proper associations with other cellular components

  • Methodological considerations:

    • Different assay environments between native membrane studies and recombinant protein studies

    • Potential effects of purification and reconstitution procedures

  • Interpretation framework:

    • Establish clear activity baselines for meaningful comparisons

    • Consider activity ratios rather than absolute values when comparing systems

    • Analyze multiple parameters (ATP synthesis, proton transport, ATPase activity)

N. europaea's obligate chemolithoautotrophy and specialized metabolism for ammonia oxidation make the native environment particularly important for proper ATP synthase function, potentially leading to activity differences in recombinant systems.

What bioinformatic approaches are useful for analyzing the evolution and specialization of atpB in ammonia-oxidizing bacteria?

Bioinformatic analyses can reveal important insights about atpB evolution in the context of ammonia oxidation:

  • Comparative sequence analysis:

    • Multiple sequence alignment of atpB from diverse bacteria

    • Identification of conserved residues specific to ammonia oxidizers

    • Analysis of selection pressures using dN/dS ratios

  • Structural modeling:

    • Homology modeling based on available ATP synthase structures

    • Prediction of ammonia oxidizer-specific structural adaptations

    • Molecular dynamics simulations to identify functional differences

  • Genomic context analysis:

    • Examination of ATP synthase operon organization across ammonia oxidizers

    • Identification of co-evolved genes and potential functional associations

    • Analysis of regulatory elements in atpB promoter regions

  • Phylogenetic approaches:

    • Construction of atpB-based phylogenies compared to species phylogenies

    • Identification of horizontal gene transfer events

    • Correlation with ecological niches and metabolic strategies

These analyses should consider that N. europaea belongs to the β-subdivision of proteobacteria, which includes other terrestrial ammonia-oxidizing bacteria , providing context for evolutionary comparisons.

What are the common technical issues when working with recombinant N. europaea atpB and how can they be addressed?

Researchers face several technical challenges when working with recombinant atpB:

Technical ChallengeSolution ApproachImplementation Details
Protein aggregationOptimize solubilization conditionsScreen detergent types, concentrations, and lipid additives
Low expression yieldRefine expression parametersAdjust induction timing, temperature, and strain selection
Loss of function during purificationGentle purification methodsUse affinity chromatography with minimal steps, avoid harsh conditions
Improper foldingChaperone co-expressionInclude molecular chaperones specific for membrane proteins
Difficulty in functional assessmentDevelop sensitive assaysEmploy fluorescent probes for proton transport, coupled enzyme assays for ATP synthesis
Instability of purified proteinOptimize buffer compositionInclude stabilizing agents like glycerol, specific lipids, or appropriate salt concentrations
Incomplete complex formationCo-expression of interacting subunitsExpress multiple ATP synthase components simultaneously

These approaches should consider N. europaea's specific adaptations, including its nutritional requirements for mineral salts and its specialized metabolism for ammonia oxidation .

How can researchers distinguish between direct effects of atpB mutations and secondary metabolic adaptations in N. europaea?

Distinguishing primary from secondary effects requires multi-faceted approaches:

  • Time-course studies:

    • Monitor changes immediately following mutation introduction

    • Track adaptation over time to identify secondary responses

  • Complementation analysis:

    • Reintroduce wild-type atpB to mutant strains

    • Assess which phenotypes are directly reversed

  • Controlled expression systems:

    • Use inducible promoters to modulate atpB expression

    • Observe dose-dependent phenotypes

  • Systems biology approaches:

    • Integrated transcriptomic, proteomic, and metabolomic analysis

    • Network analysis to identify directly affected pathways versus compensatory responses

  • Targeted metabolic analysis:

    • Focus on immediate energy parameters (ATP/ADP ratio, membrane potential)

    • Compare to more distant metabolic effects

This multi-layered analysis is particularly important in N. europaea given its obligate chemolithoautotrophic lifestyle and limited metabolic flexibility , which may lead to complex compensatory responses similar to those observed in nirK mutants .

How might CRISPR-Cas9 genome editing be applied to study atpB function in N. europaea?

CRISPR-Cas9 technologies offer powerful approaches for atpB research:

  • Precise genetic manipulation:

    • Introduction of point mutations to study specific residues

    • Creation of truncations or domain swaps

    • Insertion of reporter tags at the genomic level

  • Regulatory studies:

    • Modification of promoter elements

    • Creation of inducible expression systems

    • Engineering of ribosome binding sites to modulate expression levels

  • Physiological studies:

    • Generation of conditional knockdowns for essential genes like atpB

    • Creation of regulated degradation systems

    • Implementation of CRISPRi for tunable repression

  • High-throughput approaches:

    • CRISPR screening with guide RNA libraries targeting atpB

    • Multiplex editing to study interactions with other components

    • Base editing for specific amino acid substitutions

These approaches must be tailored to N. europaea's characteristics, including consideration of its obligate chemolithoautotrophic metabolism and appropriate selection markers that function in this specialized bacterium.

What are the potential applications of structural biology techniques in understanding the specialized features of N. europaea ATP synthase?

Advanced structural techniques can reveal unique adaptations of N. europaea ATP synthase:

  • Cryo-electron microscopy:

    • Determination of complete ATP synthase structure

    • Visualization of conformational changes during catalysis

    • Identification of N. europaea-specific structural features

  • X-ray crystallography:

    • High-resolution structure of atpB

    • Co-crystallization with interacting partners

    • Analysis of ligand binding sites

  • NMR spectroscopy:

    • Dynamic studies of specific domains

    • Identification of conformational changes

    • Characterization of protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry:

    • Mapping of solvent-accessible regions

    • Identification of conformational changes

    • Detection of interaction interfaces

  • Single-molecule techniques:

    • FRET studies to observe conformational dynamics

    • Optical tweezers to measure mechanical forces

    • Nanodiscs for controlled environment studies

These structural insights could reveal adaptations related to N. europaea's energy metabolism, which is entirely dependent on ammonia oxidation , potentially showing unique features that optimize ATP synthesis under these specific conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.