Recombinant Nitrosomonas europaea Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nitrosomonas europaea Glycerol-3-phosphate Acyltransferase (plsY)

Recombinant Nitrosomonas europaea Glycerol-3-phosphate acyltransferase (plsY) is a recombinant protein derived from the bacterium Nitrosomonas europaea, a gram-negative obligate chemolithoautotroph known for its role in nitrification by oxidizing ammonia to nitrite . The plsY protein, also known as glycerol-3-phosphate acyltransferase, plays a crucial role in lipid biosynthesis by catalyzing the transfer of an acyl group from acyl-CoA to glycerol-3-phosphate, forming lysophosphatidic acid, a precursor for phospholipid synthesis .

Characteristics of Recombinant Nitrosomonas europaea Glycerol-3-phosphate Acyltransferase (plsY)

  • Species: Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298)

  • Expression System: Expressed in E. coli for recombinant production .

  • Tag: His-tagged for easy purification .

  • Protein Length: Full-length protein consisting of 200 amino acids .

  • Amino Acid Sequence: The sequence begins with MITVVLIFSAYLLGSISFAVVASWLFKLPDPRSYGSRNPGATNVLRTGKKAAAAVTLLGD AGKGWVAVAAAKYGGEVWELGDEVIAGAALAVFLGHLFPIFLAFKGGKGVATSAGILLGL NPWLGVLTISTWMVVALVSRISSLSALLSALLAPLYAYFLLEKGILIMAVSIISVLLILK HRLNIANLMAGKEARIGKSS .

  • Purity: Greater than 90% as determined by SDS-PAGE .

  • Storage and Handling: Store at -20°C or -80°C. Avoid repeated freeze-thaw cycles .

Function and Role

Glycerol-3-phosphate acyltransferase (plsY) is involved in the initial steps of phospholipid biosynthesis. It catalyzes the formation of lysophosphatidic acid from glycerol-3-phosphate and acyl-CoA, which is then further processed into phosphatidic acid and eventually into various phospholipids essential for cell membrane structure and function .

Research Findings and Applications

Research on glycerol-3-phosphate acyltransferases in various organisms highlights their importance in lipid metabolism and membrane biogenesis. For Nitrosomonas europaea, understanding the role of plsY can provide insights into how this bacterium maintains its membrane integrity under different environmental conditions, given its chemolithoautotrophic lifestyle .

Table 1: Characteristics of Recombinant Nitrosomonas europaea Glycerol-3-phosphate Acyltransferase (plsY)

CharacteristicDescription
SpeciesNitrosomonas europaea (strain ATCC 19718 / NBRC 14298)
Expression SystemE. coli
TagHis-tagged
Protein LengthFull-length (200 amino acids)
Amino Acid SequenceSee detailed sequence above
Purity>90% by SDS-PAGE
Storage-20°C or -80°C

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
plsY; NE0224; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
plsY
Target Protein Sequence
MITVVLIFSAYLLGSISFAVVASWLFKLPDPRSYGSRNPGATNVLRTGKKAAAAVTLLGD AGKGWVAVAAAKYGGEVWELGDEVIAGAALAVFLGHLFPIFLAFKGGKGVATSAGILLGL NPWLGVLTISTWMVVALVSRISSLSALLSALLAPLYAYFLLEKGILIMAVSIISVLLILK HRLNIANLMAGKEARIGKSS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: neu:NE0224

STRING: 228410.NE0224

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Nitrosomonas europaea metabolism?

Glycerol-3-phosphate acyltransferase (plsY) in Nitrosomonas europaea catalyzes the first and rate-limiting step in phospholipid biosynthesis via the glycerol phosphate pathway. This enzyme transfers an acyl group from acyl-CoA to glycerol-3-phosphate, forming lysophosphatidic acid (LPA), which serves as a precursor for membrane phospholipid synthesis. In Nitrosomonas europaea, an ammonia-oxidizing bacterium, plsY is particularly important for maintaining membrane integrity during exposure to varying environmental conditions and ammonia concentrations. The enzyme plays a critical role in the adaptation of these bacteria to their ecological niches, as members of the genus Nitrosomonas are major ammonia oxidizers that catalyze the first step of nitrification in various ecosystems .

How does the structure of Nitrosomonas europaea plsY compare to other bacterial acyltransferases?

Nitrosomonas europaea plsY belongs to the PlsY family of acyltransferases, which are membrane-bound proteins typically containing 6-8 transmembrane domains. While specific structural data for N. europaea plsY is limited, comparative analysis with other bacterial plsY enzymes suggests conservation of the catalytic core and acyl-binding pocket. The enzyme likely contains a HX4D motif in the active site, which is characteristic of the PlsY family and essential for catalytic activity. Similar to mammalian GPATs, the N. europaea plsY would be expected to have specific domains for substrate binding and catalysis, though with structural adaptations that reflect its function in an ammonia-oxidizing bacterium that lives in oligotrophic environments .

What expression systems are most effective for producing recombinant Nitrosomonas europaea plsY?

For recombinant expression of Nitrosomonas europaea plsY, E. coli-based systems typically offer the best balance of yield and functionality. When selecting an expression system, researchers should consider:

  • BL21(DE3) strain: Provides good expression levels while suppressing proteolytic degradation

  • C41(DE3) or C43(DE3) strains: Specifically designed for membrane proteins and may improve folding of plsY

  • pET vector systems: Allow for tight control of expression under T7 promoter

  • Fusion tags: N-terminal His6 or MBP tags facilitate purification while potentially enhancing solubility

Expression should be conducted at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation. For membrane proteins like plsY, addition of glycerol (5-10%) to culture media can improve protein stability during expression.

What are the optimal conditions for assaying recombinant Nitrosomonas europaea plsY activity in vitro?

The optimal conditions for assaying recombinant Nitrosomonas europaea plsY activity require careful consideration of buffer composition, substrate concentrations, and detection methods. Based on the enzymatic parameters of related systems:

Standard Assay Conditions:

  • Buffer: 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 10 mM MgCl₂

  • Temperature: 30°C (reflecting Nitrosomonas growth optimum)

  • Substrates: Glycerol-3-phosphate (0.1-1 mM) and acyl-CoA donor (typically palmitoyl-CoA, 50-100 μM)

  • Detergent: 0.1% Triton X-100 (to maintain enzyme solubility)

  • Reducing agent: 1 mM DTT (to maintain thiol groups)

Detection Methods:

  • Radiometric assay using [¹⁴C]-labeled substrates with thin-layer chromatography separation

  • Coupled enzymatic assay measuring CoA release using DTNB (5,5′-dithiobis-2-nitrobenzoic acid)

  • HPLC-based methods for direct quantification of lysophosphatidic acid product

When designing activity assays, be mindful that Nitrosomonas bacteria typically have longer generation times (approximately 3.0 days) compared to most other bacteria, which may reflect in slower enzyme kinetics .

How should researchers approach site-directed mutagenesis studies of Nitrosomonas europaea plsY?

When conducting site-directed mutagenesis studies of Nitrosomonas europaea plsY, researchers should follow this systematic approach:

  • Target selection: Begin with highly conserved residues in the predicted catalytic site, particularly the HX4D motif common to plsY enzymes, and residues involved in substrate binding.

  • Mutagenesis strategy:

    • Use overlap extension PCR or commercially available kits (QuikChange)

    • Design primers with 15-20 nucleotides flanking the mutation site

    • Verify mutations through sequencing of the entire gene to confirm no unintended mutations

  • Functional analysis pipeline:

    • Express wild-type and mutant proteins under identical conditions

    • Verify protein expression levels by Western blotting

    • Compare enzyme kinetics (Km and Vmax) between wild-type and mutant proteins

    • Examine substrate specificity alterations with various acyl chain lengths

  • Structure-function interpretation:

    • Map mutations onto homology models based on related acyltransferases

    • Correlate kinetic changes with structural predictions

    • Consider complementary approaches like chemical modification or crosslinking

This approach allows for methodical characterization of the catalytic mechanism and structure-function relationships .

What strategies optimize the solubilization and purification of recombinant Nitrosomonas europaea plsY?

Optimizing solubilization and purification of recombinant Nitrosomonas europaea plsY requires addressing its membrane-bound nature. The following protocol maximizes yield while preserving activity:

Solubilization Protocol:

  • Harvest cells and prepare membrane fraction by differential centrifugation

  • Solubilize membranes using mild detergents:

    • Primary options: n-dodecyl-β-D-maltoside (DDM, 1%) or digitonin (1%)

    • Alternative options: CHAPS (0.5-1%) or Triton X-100 (0.5-1%)

  • Incubate with gentle rotation at 4°C for 1-2 hours

  • Remove insoluble material by ultracentrifugation (100,000 × g for a minimum of 30 minutes)

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Include low concentrations of detergent (0.05-0.1% DDM) in all buffers

  • Apply detergent-compatible size exclusion chromatography as a final purification step

  • Maintain 10% glycerol in all buffers to enhance protein stability

Critical Considerations:

  • Keep all procedures at 4°C to minimize protein denaturation

  • Include protease inhibitors throughout the purification process

  • Verify protein integrity by SDS-PAGE and activity assays after each purification step

  • Consider reconstitution into nanodiscs or liposomes for long-term stability and functional studies

This protocol addresses the challenging nature of membrane protein purification while maximizing the yield of functional enzyme .

How does substrate specificity of Nitrosomonas europaea plsY compare with GPATs from other organisms?

The substrate specificity of Nitrosomonas europaea plsY likely reflects its ecological niche and physiological requirements compared to GPATs from other organisms:

OrganismEnzymePreferred Acyl Chain LengthSaturation PreferenceKm for G3P (μM)Notes
Nitrosomonas europaeaplsYC16-C18 (predicted)Likely prefers saturated~50-100 (estimated)Adapted to oligotrophic freshwater environments
Mammals (GPAT1)GPATC16-C18Saturated > Unsaturated230-500Mitochondrial; role in TAG synthesis
Mammals (GPAT3/4)GPATC16-C18Less selective400-800ER localized; broader substrate range
E. coliPlsBC16-C18Adaptable50-200Primary bacterial GPAT

Nitrosomonas europaea plsY would be expected to show preference for medium to long-chain acyl-CoA substrates (particularly C16:0 or C18:0), reflecting the membrane composition necessary for ammonia oxidation in oligotrophic environments. The enzyme likely shows higher affinity for its substrates compared to mammalian GPATs, as indicated by the generally lower Km values observed in bacterial systems. Furthermore, the substrate specificity may be influenced by environmental factors such as temperature and pH, which affect membrane fluidity requirements in these specialized bacteria .

What roles does recombinant Nitrosomonas europaea plsY play in ammonia oxidation and environmental adaptation?

Recombinant Nitrosomonas europaea plsY plays multifaceted roles in ammonia oxidation and environmental adaptation through its functions in membrane phospholipid biosynthesis:

  • Membrane integrity during ammonia oxidation:

    • plsY synthesizes precursors for phospholipids that form the cytoplasmic membrane

    • The membrane houses ammonia monooxygenase complexes required for the first step of nitrification

    • Proper membrane composition ensures optimal enzyme activity and proton gradient maintenance

  • Adaptation to environmental stressors:

    • Modifies membrane phospholipid composition in response to:

      • Changes in ammonia concentration

      • Temperature fluctuations

      • pH variations

      • Oxidative stress from reactive oxygen species (ROS) generated during ammonia oxidation

  • Energy metabolism integration:

    • Links carbon metabolism with energy generation

    • Balances resource allocation between growth (requiring phospholipids) and energy production

    • Coordinates with the intracytoplasmic membranes observed in Nitrosomonas (visible in TEM studies)

  • Ecological niche specialization:

    • Contributes to the adaptation of Nitrosomonas to oligotrophic environments

    • Supports slow but efficient growth (generation time of approximately 3.0 days)

    • Enables persistence in freshwater ecosystems with varying nutrient availability

These functions highlight how plsY contributes to the specialized metabolism of ammonia-oxidizing bacteria, supporting their ecological role in nitrification while enabling adaptation to environmental challenges .

What techniques are most effective for studying the regulation of plsY expression in Nitrosomonas europaea?

To effectively study the regulation of plsY expression in Nitrosomonas europaea, researchers should employ a multi-faceted approach combining molecular, biochemical, and computational techniques:

  • Transcriptional Regulation Analysis:

    • RT-qPCR to quantify plsY mRNA levels under varying conditions

    • RNA-seq for genome-wide expression patterns to identify co-regulated genes

    • 5′ RACE to map transcription start sites and promoter regions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

  • Promoter Characterization:

    • Reporter gene assays using fluorescent proteins (e.g., GFP) fused to the plsY promoter

    • Deletion and mutation analysis of promoter elements to identify regulatory motifs

    • Electrophoretic mobility shift assays (EMSA) to confirm protein-DNA interactions

  • Environmental Response Characterization:

    • Monitor expression changes in response to:

      • Ammonia concentration gradients

      • Oxygen availability

      • pH fluctuations

      • Nutrient limitation

      • Oxidative stress conditions

  • Post-transcriptional Regulation:

    • Northern blotting to assess mRNA stability

    • Polysome profiling to evaluate translational efficiency

    • Western blotting to correlate mRNA levels with protein abundance

  • Systems Biology Approaches:

    • Metabolic flux analysis to correlate plsY expression with phospholipid synthesis rates

    • Network analysis to position plsY within the larger regulatory network

    • Comparative genomics across Nitrosomonas strains to identify conserved regulatory elements

These methodologies, when combined, provide comprehensive insights into how Nitrosomonas europaea regulates plsY expression in response to environmental signals, metabolic needs, and growth phases .

How can researchers address common challenges in recombinant expression of Nitrosomonas europaea plsY?

Researchers frequently encounter challenges when expressing recombinant Nitrosomonas europaea plsY. Here are methodological solutions for common issues:

ChallengePotential CausesSolution Approaches
Low expression levelsCodon bias, toxicity to host- Optimize codons for expression host
- Use tightly regulated expression systems (e.g., pBAD)
- Co-express with chaperones (GroEL/ES, DnaK/J)
- Lower induction temperature to 16-18°C
Inclusion body formationRapid overexpression, improper folding- Reduce inducer concentration (0.1 mM IPTG)
- Express as fusion with solubility tags (MBP, SUMO)
- Add 5-10% glycerol to growth medium
- Use auto-induction media for gradual expression
Low enzyme activityImproper folding, missing cofactors- Reconstitute in lipid environment (nanodiscs)
- Supplement reaction with potential cofactors
- Ensure reducing environment (1-5 mM DTT)
- Test activity in native membrane extracts as comparison
Protein instabilityProtease degradation, aggregation- Include multiple protease inhibitors
- Maintain constant low temperature (4°C)
- Add glycerol (10-15%) to all buffers
- Consider detergent screening (DDM, CHAPS, digitonin)
Poor purification yieldWeak binding to affinity resins- Optimize tag position (N vs. C-terminal)
- Test alternative affinity tags
- Include imidazole wash steps to reduce non-specific binding
- Consider tandem affinity purification strategy

When troubleshooting expression issues, implement systematic changes one at a time and maintain detailed records of conditions and outcomes. Comparative analysis with successful expression of other membrane-associated enzymes can provide valuable insights for optimization .

What statistical approaches are appropriate for analyzing kinetic data from recombinant Nitrosomonas europaea plsY experiments?

Analyzing kinetic data from recombinant Nitrosomonas europaea plsY experiments requires careful statistical treatment to ensure reliable interpretation. The following methodological approaches are recommended:

  • Michaelis-Menten Kinetics Analysis:

    • Use non-linear regression rather than linear transformations (avoid Lineweaver-Burk plots)

    • Apply weighted least squares fitting to account for heteroscedasticity in enzyme assays

    • Calculate 95% confidence intervals for Km and Vmax parameters

    • Verify goodness of fit using residual plots and R² values

  • Substrate Specificity Comparisons:

    • Use one-way ANOVA with post-hoc Tukey tests for comparing activity across multiple substrates

    • Apply paired t-tests when comparing wild-type and mutant enzymes with the same substrate

    • Calculate specificity constants (kcat/Km) with propagated errors for each substrate

  • Inhibition Studies:

    • Use global fitting approaches for competitive, non-competitive, or mixed inhibition models

    • Apply Akaike Information Criterion (AIC) to determine the best-fitting inhibition model

    • Calculate Ki values with proper statistical confidence intervals

  • Environmental Variable Effects:

    • Implement multiple regression analysis for multifactorial experimental designs

    • Use response surface methodology to optimize multiple parameters simultaneously

    • Apply two-way ANOVA to assess interaction effects between factors (e.g., pH and temperature)

  • Data Validation and Reporting:

    • Perform a minimum of three independent experiments with technical replicates

    • Report mean values with standard error of the mean (SEM)

    • Apply outlier tests (Grubbs' test) before removing any data points

    • Present residual plots alongside fitted curves

These statistical approaches ensure robust analysis of enzyme kinetic data, facilitating reliable comparison with other acyltransferases and accurate characterization of the enzymatic properties of Nitrosomonas europaea plsY .

How can researchers integrate structural modeling and molecular dynamics to understand Nitrosomonas europaea plsY function?

Integrating structural modeling and molecular dynamics provides powerful insights into Nitrosomonas europaea plsY function, particularly when crystal structures are unavailable. This methodological framework enables prediction of catalytic mechanisms and substrate interactions:

  • Homology Modeling Protocol:

    • Identify structural templates through PSI-BLAST against the PDB database

    • Generate multiple sequence alignments with other bacterial acyltransferases

    • Build models using software such as MODELLER or SWISS-MODEL

    • Refine models through energy minimization focusing on the catalytic site

    • Validate models using Ramachandran plots, DOPE scores, and ProSA

  • Molecular Docking Approach:

    • Prepare ligand structures (glycerol-3-phosphate and acyl-CoA)

    • Define binding site based on conserved catalytic residues

    • Perform flexible docking using AutoDock Vina or GOLD

    • Evaluate binding poses through scoring functions and consistency with experimental data

    • Identify key residues forming the substrate binding pocket

  • Molecular Dynamics Simulation Strategy:

    • Embed protein model in a simulated phospholipid bilayer using CHARM-GUI

    • Parameterize the system using CHARMM36 or AMBER force fields

    • Run simulations (minimum 100 ns) under NPT ensemble at 303K

    • Analyze trajectory for:

      • Protein structural stability (RMSD)

      • Substrate binding dynamics

      • Water and ion accessibility to the active site

      • Conformational changes during catalytic cycle

  • Integration with Experimental Data:

    • Correlate predicted substrate interactions with kinetic parameters

    • Guide mutagenesis studies based on structural predictions

    • Validate dynamics predictions through hydrogen-deuterium exchange experiments

    • Refine models iteratively based on experimental feedback

This integrated computational approach provides a framework for understanding the structure-function relationships of Nitrosomonas europaea plsY at the molecular level, generating testable hypotheses about catalytic mechanism and substrate specificity .

What are promising approaches for engineering Nitrosomonas europaea plsY for altered substrate specificity?

Engineering Nitrosomonas europaea plsY for altered substrate specificity represents an exciting frontier in enzyme modification. Researchers can employ the following methodological strategies:

  • Rational Design Approach:

    • Target residues forming the acyl-chain binding pocket based on homology models

    • Implement conservative mutations that alter pocket size (e.g., Val→Ala to expand, Ala→Val to restrict)

    • Modify hydrophobicity patterns to accommodate different acyl chain structures

    • Engineer hydrogen bonding networks to alter head group recognition

  • Semi-rational Library Construction:

    • Create focused libraries using site-saturation mutagenesis at 3-5 key positions simultaneously

    • Apply computational design tools (Rosetta, FoldX) to predict stabilizing combinations

    • Use degenerate primers (NNK codons) to reduce library size while maintaining diversity

    • Implement combinatorial active site saturation testing (CASTing) for spatially adjacent residues

  • High-throughput Screening Development:

    • Design colorimetric assays compatible with microplate format

    • Develop selection systems linking altered specificity to bacterial survival

    • Implement FACS-based screening using fluorogenic substrate analogs

    • Apply droplet microfluidics for ultra-high-throughput screening

  • Directed Evolution Strategy:

    • Use error-prone PCR with controlled mutation rates (2-5 mutations per gene)

    • Implement DNA shuffling with related acyltransferases from other organisms

    • Apply iterative rounds of selection with gradually increasing stringency

    • Combine beneficial mutations identified in separate lineages

By systematically applying these methodologies, researchers can develop variants of Nitrosomonas europaea plsY with altered substrate preferences, potentially enabling the biosynthesis of novel phospholipids with applications in biotechnology and membrane research .

How might environmental factors influence the function and regulation of Nitrosomonas europaea plsY in situ?

Understanding how environmental factors influence Nitrosomonas europaea plsY function in situ requires examining the ecological context of these ammonia-oxidizing bacteria:

  • Ammonia Concentration Effects:

    • At low concentrations (oligotrophic conditions), plsY activity likely optimizes membrane composition for high-affinity ammonia transporters

    • At higher concentrations, membrane composition may shift to accommodate increased metabolic activity

    • The apparent half-saturation constant (Km) for ammonia utilization in Nitrosomonas (approximately 57.9 μM NH3+NH4+) suggests adaptation to specific ammonia ranges that may influence membrane composition requirements

  • Temperature-Dependent Regulation:

    • Cold temperatures likely trigger increased unsaturated fatty acid incorporation requiring plsY adaptation

    • Warm temperatures may elicit changes in acyl chain length preferences

    • Temperature shifts could alter enzyme kinetics, with implications for membrane fluidity maintenance

  • pH-Mediated Responses:

    • Acidic environments may require altered membrane composition to maintain proton gradients

    • pH fluctuations could influence the ionization state of plsY catalytic residues

    • Adaptation to pH ranges requires coordinated regulation of plsY with other phospholipid biosynthetic enzymes

  • Oxygen Availability Impacts:

    • As obligate aerobes, Nitrosomonas requires oxygen for ammonia oxidation

    • Oxygen limitation may trigger stress responses affecting membrane composition

    • Oxidative stress from ROS production during ammonia oxidation necessitates membrane adaptations mediated by plsY

  • Seasonal and Diurnal Cycles:

    • Temporal variations in nutrients and temperature likely drive cyclic regulation of plsY

    • Adaptation to regular environmental fluctuations may involve anticipatory regulation of phospholipid synthesis

Understanding these environmental influences requires integrating laboratory studies with field observations, potentially using metatranscriptomics and metaproteomics to assess plsY expression in natural Nitrosomonas populations across varying environmental conditions .

What potential applications exist for recombinant Nitrosomonas europaea plsY in synthetic biology and biotechnology?

Recombinant Nitrosomonas europaea plsY offers diverse applications in synthetic biology and biotechnology, leveraging its unique properties as an acyltransferase from an ammonia-oxidizing bacterium:

  • Designer Membrane Engineering:

    • Create artificial membranes with custom phospholipid compositions

    • Develop specialized liposomes for drug delivery with unique stability properties

    • Engineer bacterial cells with altered membrane properties for bioremediation applications

    • Design temperature-responsive membrane systems for controlled release applications

  • Biocatalysis Applications:

    • Synthesize novel phospholipids with non-natural fatty acids

    • Produce specialized lysophosphatidic acid derivatives as signaling molecule precursors

    • Develop enzyme cascades for one-pot synthesis of complex lipids

    • Create immobilized enzyme reactors for continuous phospholipid modification

  • Biosensor Development:

    • Engineer whole-cell biosensors using plsY-reporter gene fusions to detect environmental ammonia

    • Develop enzyme-based electrochemical sensors for acyl-CoA detection

    • Create optical biosensors for monitoring phospholipid synthesis in real-time

    • Design environmental monitoring systems for wastewater treatment optimization

  • Metabolic Engineering Platforms:

    • Incorporate into synthetic pathways for microbial production of high-value lipids

    • Optimize phospholipid synthesis in heterologous hosts for membrane protein production

    • Engineer synthetic microbial consortia with customized cell-cell interaction interfaces

    • Create artificial cells with minimal genomes utilizing plsY as a core component

  • Biotechnological Process Enhancement:

    • Improve nitrification efficiency in wastewater treatment through engineered Nitrosomonas

    • Develop bioremediation strategies for ammonia-contaminated environments

    • Create robust biocatalysts capable of functioning in extreme conditions

    • Design self-assembling phospholipid structures for material science applications

These applications leverage the unique properties of Nitrosomonas europaea plsY, particularly its adaptation to function in specialized ecological niches and its potential for substrate engineering .

What are the most critical knowledge gaps in understanding Nitrosomonas europaea plsY structure and function?

Several critical knowledge gaps remain in our understanding of Nitrosomonas europaea plsY structure and function that warrant focused research attention:

  • Structural Characterization:

    • No high-resolution crystal or cryo-EM structure exists for any Nitrosomonas europaea acyltransferase

    • The precise arrangement of transmembrane domains and the architecture of the active site remain theoretical

    • The structural basis for substrate recognition, particularly for acyl-CoA binding, is poorly understood

  • Catalytic Mechanism:

    • The detailed reaction mechanism, including transition states and rate-limiting steps, remains uncharacterized

    • The roles of specific residues in catalysis beyond the predicted HX4D motif need experimental verification

    • Potential allosteric regulation mechanisms and conformational changes during catalysis are unknown

  • Regulatory Networks:

    • The transcriptional and post-translational regulation of plsY in response to environmental signals is largely unexplored

    • Integration with the broader metabolic network of Nitrosomonas europaea is poorly understood

    • Potential protein-protein interactions that may modulate plsY activity have not been identified

  • Physiological Context:

    • The precise roles of plsY-synthesized phospholipids in supporting ammonia oxidation remain speculative

    • The relationship between membrane composition and ammonia monooxygenase activity is not well characterized

    • How plsY activity coordinates with cellular energy status and ammonia availability needs clarification

  • Evolutionary Aspects:

    • The evolutionary history and selective pressures that shaped plsY in ammonia-oxidizing bacteria are unknown

    • How plsY diversity contributes to niche adaptation across different Nitrosomonas strains has not been explored

    • Horizontal gene transfer events involving plsY and their ecological significance require investigation

Addressing these knowledge gaps would significantly advance our understanding of phospholipid metabolism in ammonia-oxidizing bacteria and potentially reveal novel biotechnological applications .

What best practices should researchers follow when publishing findings related to recombinant Nitrosomonas europaea plsY?

Researchers publishing findings on recombinant Nitrosomonas europaea plsY should adhere to these best practices to ensure reproducibility and maximum research impact:

  • Experimental Reporting Standards:

    • Provide complete sequences of all recombinant constructs, including tags and linkers

    • Detail expression conditions with precise parameters (temperature, media composition, induction protocol)

    • Report purification protocols with buffer compositions, column types, and elution conditions

    • Include SDS-PAGE images showing protein purity and Western blots confirming identity

  • Enzyme Characterization Fundamentals:

    • Report enzyme kinetics with standard error values and number of replicates (n ≥ 3)

    • Specify all assay conditions (pH, temperature, buffer composition, substrate concentrations)

    • Include controls for background activity and substrate stability

    • Present complete datasets rather than only processed results

  • Structural Analysis Documentation:

    • Deposit structural models in appropriate databases with validation metrics

    • Provide raw data for biophysical characterizations (CD spectra, thermal shift assays)

    • Include multiple model validation metrics when presenting homology models

    • Document all parameters and force fields used in molecular dynamics simulations

  • Biological Context Integration:

    • Relate findings to physiological roles in Nitrosomonas europaea

    • Compare results with other acyltransferases, highlighting similarities and differences

    • Discuss implications for ammonia oxidation and environmental adaptation

    • Address limitations in extrapolating in vitro findings to in vivo function

  • Data and Resource Sharing:

    • Deposit plasmids in public repositories (Addgene)

    • Provide detailed protocols as supplementary materials

    • Share raw data in appropriate repositories (e.g., Zenodo, Dryad)

    • Make analysis scripts and code available (GitHub)

Adhering to these best practices ensures that research on Nitrosomonas europaea plsY contributes effectively to the broader scientific understanding of bacterial phospholipid metabolism and enables subsequent research to build upon published findings .

How can collaborative approaches accelerate research on Nitrosomonas europaea plsY and related enzymes?

Accelerating research on Nitrosomonas europaea plsY through collaborative approaches requires strategic integration of diverse expertise and methodologies:

  • Interdisciplinary Research Consortia:

    • Combine expertise from structural biology, enzymology, microbial physiology, and ecology

    • Integrate computational modeling teams with experimental laboratories

    • Incorporate environmental microbiology perspectives with biochemical characterization

    • Develop shared research priorities and coordinated experimental approaches

    • Implement regular virtual symposia to share unpublished results and troubleshooting strategies

  • Technology Sharing Platforms:

    • Establish repositories for verified expression constructs and purification protocols

    • Create databases of enzyme variants with phenotypic and kinetic characterizations

    • Develop shared computational pipelines for structural analysis and modeling

    • Implement standardized assay methods for consistent cross-laboratory comparisons

    • Share specialized equipment and expertise through collaborative research visits

  • Coordinated Research Networks:

    • Design complementary research objectives distributed across laboratories

    • Implement round-robin experimental verification of key findings

    • Establish benchmark datasets for validating computational predictions

    • Coordinate sampling from diverse environments to assess ecological distributions

    • Develop shared funding strategies to support long-term collaborative projects

  • Open Science Approaches:

    • Implement preprint publication of results prior to peer review

    • Establish open electronic lab notebooks for real-time sharing of protocols and results

    • Create community-curated databases of Nitrosomonas enzyme characteristics

    • Develop citizen science projects for environmental sampling and preliminary screening

    • Host hackathons focusing on computational challenges in enzyme modeling

  • Educational Integration:

    • Develop undergraduate and graduate research projects spanning multiple laboratories

    • Create shared curriculum materials for training in specialized techniques

    • Implement collaborative mentoring approaches for early-career researchers

    • Establish summer institutes bringing together researchers from diverse backgrounds

    • Design cross-institutional courses focusing on integrative approaches to enzyme research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.