Recombinant Nitrosomonas europaea Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; NE0387; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
yidC
Target Protein Sequence
MDNKKIVLLIIFSTSLLFLWDAWIKEQEKFNNPPAITQADSSAGSTQSRNDDSLPVPGSE LTSSQASPDTNGIPASGGNGDSVTPRLLPSGEQIRVVTDKVIAEIDTIGGDLRRLELLQQ PSSEDKDTPYALLYSEAARTYIAQSGLVGEGLPNHKTTFRAESDIRNYELSSGEDKIVIR LLAPEAQGVQVIKTYTFHRDSYVIDVGFEVENKGDATVRPFAYFQMLRDGNPPPAKTMMI PTFLGAAVYTEEGKYQKIPFSDLDKNKADYPANANNGWIAMLEHYFLTAWLPQQQTPREF FAKRQSDNLYSAGVIVPAGVIAPGEIAATTMPFYAGPEEQDNLEGLAPGLDLTVDYGWLT VIAKPLFRLLSFYHSWTDNWGVAIILLTMTVKLLFFPLSAAGYRSMAKLRLVTPKLKRIQ DQYKGDRQRMHQAMMEFYKEEKINPMGGCFPILVQIPVFIALYWTILAAVELRYAPLALW IDDLSSPDPFYMLPLLMGISMFVQTKLNPTPTDPLQAKIMQIMPVAFSAIFFFFPAGLVL YSLVNNILSIAQQWKITKMYGTAPSKDTPEPPVSKQVNSSENPETTANSPADSPKQPQTP ANNPRKMYKRTRKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: neu:NE0387

STRING: 228410.NE0387

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial cells?

YidC is a 61 kDa membrane protein that functions as both an insertase and a chaperone for membrane proteins. It plays a critical role in the insertion process of newly synthesized membrane proteins into the lipid bilayer. YidC specifically facilitates the insertion of membrane proteins and not the translocation of exported proteins. Its primary function appears to be recognizing hydrophobic regions of membrane proteins and catalyzing their integration in a transmembrane orientation into the membrane bilayer . YidC belongs to a highly conserved family that includes Oxa1p in mitochondria and Alb3 in chloroplasts, suggesting its evolutionary significance across different biological systems .

How does YidC interact with the Sec translocase system?

YidC can function in two distinct modes: (1) in conjunction with the SecYEG pathway to facilitate folding and assembly of membrane proteins inserted by the Sec translocase, or (2) as an independent pathway for membrane protein insertion . When working with the Sec system, YidC has been found to copurify with SecYEGDF components . Studies using the membrane protein FtsQ demonstrated that nascent chains first contact SecY and then YidC during the insertion process . This functional relationship between YidC and Sec was further supported by observed inhibition of protein export when Sec-dependent membrane proteins were stalled within the Sec translocase under conditions where YidC is limiting and membrane proteins are overproduced .

What is the evidence that YidC can function independently of the Sec system?

Experimental evidence demonstrates that YidC can function separately from the Sec translocase. When purified YidC was reconstituted into proteoliposomes, it efficiently supported the membrane insertion of the single-spanning Pf3 coat protein without requiring any Sec components . Additionally, in vivo experiments using conditionally depleted E. coli strains showed that some membrane proteins, such as melibiose permease (MelB), can insert into the cytoplasmic membrane in the absence of SecYEG as long as YidC is present . These findings confirm that YidC can function as an independent insertase pathway for certain membrane proteins.

How exactly does YidC facilitate the folding of polytopic membrane proteins?

YidC assists membrane protein folding through a stepwise and stochastic process. Single-molecule force spectroscopy (SMFS) experiments reveal that YidC prevents misfolding by stabilizing the unfolded state of substrate proteins, from which structural segments can insert one after another into the membrane until folding is completed . During this stepwise insertion, YidC and the membrane together stabilize transient folds. Remarkably, the order of insertion of structural segments is stochastic, indicating that membrane proteins like lactose permease (LacY) can fold along variable pathways toward the native structure . For complex polytopic membrane proteins with pseudo-symmetric domains (like MelB), YidC accelerates and chaperones the stepwise insertion and folding process of multiple folding cores .

What regions of polytopic membrane proteins are particularly prone to misfolding in the absence of YidC?

In the absence of YidC, specific structural regions of polytopic membrane proteins are particularly susceptible to misfolding. For instance, in LacY, structural segments S4, S6, and S7 showed the highest probability for misfolding without YidC assistance . Segments S6 and S7 contain transmembrane α-helices V, VI, VII and a long cytoplasmic loop . Similarly, in MelB, misfolding predominantly occurs in structural regions that interface the pseudo-symmetric α-helical domains . These findings suggest that YidC is especially important for chaperoning the folding of structurally complex regions and domain interfaces in polytopic membrane proteins.

How can researchers experimentally determine which segments of a membrane protein require YidC for proper folding?

Researchers can use single-molecule force spectroscopy (SMFS) to identify which segments of a membrane protein depend on YidC for proper folding. The experimental approach involves:

  • Reconstituting the membrane protein of interest in phospholipid membranes with and without YidC

  • Using SMFS to mechanically unfold individual membrane proteins by applying force to the C-terminus

  • Analyzing the force-distance curves to identify the characteristic unfolding pattern ("fingerprint") of the native protein

  • Performing refolding experiments by partially unfolding the protein and allowing it to refold under controlled conditions

  • Comparing the refolding patterns in the presence and absence of YidC to identify segments prone to misfolding

  • Assigning observed force peaks to specific structural segments by comparison with the native fingerprint spectrum

This methodology can precisely map which structural regions are protected from misfolding by YidC activity.

What reconstitution systems can be used to study YidC function in vitro?

To study YidC function in vitro, researchers can use the following reconstitution systems:

  • Proteoliposomes with purified YidC: Purified YidC can be reconstituted into liposomes composed of phospholipids such as phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) at ratios mimicking bacterial membranes (e.g., PE:PG at 3:1) . This system allows the study of YidC's function independent of other cellular components.

  • Co-reconstitution of YidC with substrate proteins: YidC can be co-reconstituted with membrane proteins of interest, such as LacY or MelB, to study their interactions and folding dynamics .

  • Energized proteoliposomes: Creating a membrane potential (ΔΨ) across the proteoliposome membrane can be important for certain insertion processes. For example, the Pf3 coat protein insertion was shown to be slightly enhanced by the presence of a membrane potential across YidC proteoliposomes .

Verification of proper reconstitution can be performed using techniques like SDS-PAGE, atomic force microscopy (AFM) imaging, and SMFS .

What are the key considerations for expressing recombinant YidC in Nitrosomonas europaea?

Based on the available information about N. europaea and membrane protein expression, researchers should consider the following when expressing recombinant YidC in this organism:

  • Growth conditions: N. europaea grows aerobically at 30°C in specific media such as P medium [containing (NH₄)₂SO₄, KH₂PO₄, Na₂HPO₄, NaHCO₃, MgSO₄·7H₂O, CaCl₂·2H₂O, and Fe-EDTA at pH 8.0] and requires darkness for optimal growth .

  • Expression vectors: Plasmid vectors that have been successfully used in N. europaea, such as those carrying V. harveyi luxAB genes, could be adapted for YidC expression .

  • Antibiotic selection: Kanamycin at 25 μg/ml has been used successfully for selection of recombinant N. europaea strains .

  • Metabolism considerations: As a chemoautotrophic ammonia-oxidizing bacterium, N. europaea obtains energy by oxidizing ammonia to nitrite, which may affect protein expression capacity compared to heterotrophic hosts .

  • Protein localization: Since YidC is a membrane protein, proper targeting to the cytoplasmic membrane of N. europaea must be ensured.

  • Functional verification: Testing whether recombinant YidC can complement YidC-depleted strains or assist in the folding of model substrates would be essential to confirm functionality.

What techniques are most effective for monitoring YidC-assisted membrane protein insertion in real-time?

Several techniques can be employed to monitor YidC-assisted membrane protein insertion in real-time:

  • Single-molecule force spectroscopy (SMFS): This technique has been particularly effective in observing the YidC-assisted folding trajectory of polytopic membrane proteins. SMFS allows researchers to mechanically unfold membrane proteins and then monitor their refolding in the presence or absence of YidC with nanometer precision .

  • Protease protection assays: By monitoring the protection of specific regions of membrane proteins from protease digestion over time, researchers can track the kinetics of membrane insertion. In YidC proteoliposomes, the kinetics of the Pf3 coat protein insertion have been analyzed by stopping the reaction at various time points using chilling and proteinase K addition .

  • Fluorescence-based approaches: Incorporating fluorescent probes or tags at specific positions in the substrate protein can allow real-time monitoring of conformational changes during insertion and folding.

  • Crosslinking studies: Time-resolved crosslinking between YidC and substrate proteins can capture transient interactions during the insertion process.

  • Electrophysiological measurements: For channel-forming membrane proteins, electrophysiological techniques can monitor real-time insertion and folding by measuring conductance changes.

How does the substrate specificity of YidC compare between different bacterial species?

To investigate this question, researchers could:

  • Perform complementation studies by expressing YidC from different bacterial species in YidC-depleted E. coli and testing the ability to insert various model substrates

  • Conduct comparative proteomic analyses of membrane proteins affected by YidC depletion in different bacterial species

  • Compare the structural features of YidC homologs from different species using cryo-EM or X-ray crystallography

  • Use chimeric constructs combining domains from YidC proteins of different species to determine which regions confer substrate specificity

For N. europaea specifically, which has unique bioenergetic requirements as a chemoautotroph, the substrate specificity of its YidC might be adapted to its specialized metabolism and membrane protein composition.

What factors determine whether a membrane protein follows the YidC-only pathway versus the Sec-YidC cooperative pathway?

Several factors appear to influence whether a membrane protein utilizes the YidC-only pathway or requires cooperation between YidC and the Sec translocase:

  • Hydrophobicity of transmembrane segments: Proteins with highly hydrophobic transmembrane regions may insert more readily via the YidC-only pathway. This is illustrated by the mutant Pf3 coat protein with an extended hydrophobic region, which inserted independently of YidC into the membrane both in vivo and in vitro (although its insertion was accelerated by YidC) .

  • Topology complexity: Simple single-spanning membrane proteins like the Pf3 coat protein can utilize the YidC-only pathway , while more complex polytopic membrane proteins may require the cooperative action of both systems.

  • Charge distribution: The distribution of charged residues, particularly in regions flanking transmembrane segments, may influence pathway selection.

  • Size and folding of periplasmic domains: Large periplasmic domains may require the Sec translocase for efficient translocation.

  • Kinetic considerations: Some proteins like MelB can utilize the YidC-only pathway if YidC is available, even though they might normally use the Sec-YidC cooperative pathway under physiological conditions .

Further research using systematic mutagenesis of model substrates and pathway-specific inhibitors could help elucidate the precise determinants of pathway selection.

How might the function of YidC be affected by the unique bioenergetic metabolism of Nitrosomonas europaea?

As a chemoautotrophic ammonia-oxidizing bacterium, N. europaea has a distinct energy metabolism compared to heterotrophic bacteria like E. coli . This unique metabolism might influence YidC function in several ways:

  • Energy constraints: N. europaea generates energy from ammonia oxidation, which might provide different levels of proton motive force across the membrane compared to heterotrophs. Since some YidC-assisted insertion processes are enhanced by membrane potential , this could affect insertion efficiency.

  • Membrane composition: Differences in membrane lipid composition between N. europaea and other bacteria might affect how YidC interacts with the membrane and its substrate proteins.

  • Specialized membrane proteins: N. europaea requires specialized membrane proteins for its ammonia oxidation metabolism, which might have evolved unique interactions with YidC.

  • Redox sensitivity: The redox environment in N. europaea might differ due to its ammonia oxidation pathway, potentially affecting YidC activity if it has redox-sensitive regions.

  • Regulatory mechanisms: The expression and activity of YidC might be regulated differently in N. europaea in response to its unique metabolic needs.

Experimental approaches to investigate these questions could include comparing the insertion efficiency of model substrates in reconstituted systems with YidC from N. europaea versus E. coli under different energetic conditions.

What are common challenges in purifying functional YidC for in vitro studies?

When purifying YidC for functional studies, researchers often encounter several challenges:

  • Maintaining native conformation: As a membrane protein, YidC can easily denature during extraction from the membrane. Using mild detergents and optimizing buffer conditions is crucial.

  • Aggregation: YidC may aggregate when removed from its native membrane environment. Adding stabilizing agents or using amphipols can help maintain monodispersity.

  • Loss of function: The purification process may lead to loss of functional activity. Functional assays, such as the ability to insert Pf3 coat protein into proteoliposomes , should be used to verify activity at each purification step.

  • Orientation in reconstituted systems: When reconstituting YidC into proteoliposomes, achieving the correct orientation is critical. The orientation can be verified using protease protection assays that generate characteristic fragments (e.g., a 42 kDa trypsin-resistant fragment representing the periplasmic domain) .

  • Co-purification of interacting proteins: YidC may co-purify with other membrane components like SecYEGDF , which could complicate analysis of YidC-specific functions.

  • Scale-up challenges: Obtaining sufficient quantities of purified YidC for structural and functional studies can be difficult due to relatively low expression levels of membrane proteins.

What controls are essential when studying YidC-mediated membrane protein insertion?

When studying YidC-mediated membrane protein insertion, several controls are essential:

How can researchers optimize recombinant expression of YidC in different bacterial hosts?

To optimize recombinant expression of YidC in different bacterial hosts, including potentially N. europaea, researchers should consider:

  • Codon optimization: Adapting the YidC coding sequence to the codon usage preference of the host organism can improve expression levels.

  • Promoter selection: Using promoters appropriate for the host organism is crucial. For N. europaea, which has been successfully used with expression vectors carrying genes like V. harveyi luxAB , identifying promoters active in this organism is essential.

  • Growth conditions: Optimizing growth conditions specific to the host organism. For N. europaea, this includes aerobic growth at 30°C in appropriate media like P medium in the dark .

  • Induction systems: Selecting appropriate induction systems for the host. For membrane proteins, slower induction often yields better results.

  • Selection markers: Using appropriate antibiotic selection. For N. europaea, kanamycin at 25 μg/ml has been used successfully .

  • Fusion tags: Strategic use of fusion tags can aid in expression monitoring and purification, but may affect function and should be validated.

  • Toxicity mitigation: Overexpression of membrane proteins can be toxic to host cells, so expression levels should be carefully controlled, possibly using tightly regulated inducible systems.

  • Functional verification: Confirming that recombinantly expressed YidC is functional, potentially through complementation assays in YidC-depleted strains or in vitro insertion assays with purified protein.

Comparative Properties of YidC and Its Homologs

ProteinOrganism/OrganelleMolecular WeightFunctionKey Structural FeaturesReference
YidCEscherichia coli61 kDaMembrane protein insertion and foldingPeriplasmic domain between first two transmembrane regions
Oxa1pMitochondriaVariable by speciesInsertion of proteins from matrix into inner membraneFunctions in absence of Sec translocase
Alb3ChloroplastsVariable by speciesMembrane protein insertionHighly conserved with YidC and Oxa1p

Experimental Conditions for YidC Reconstitution and Functional Assays

Experimental SystemComponentsLipid CompositionBuffer ConditionsTemperatureSubstrate ProteinDetection MethodReference
YidC ProteoliposomesPurified YidC (~50 molecules per liposome)Not specified in detailEnergized (with membrane potential)Not specifiedPf3 coat proteinProteinase K protection
YidC-LacY Co-reconstitutionPurified YidC and LacYPE:PG (3:1)Not specified in detailNot specifiedLacYSingle-molecule force spectroscopy
N. europaea GrowthNot applicableNot applicableP medium [2.5 g (NH₄)₂SO₄, 0.7 g KH₂PO₄, 13.5 g Na₂HPO₄, 0.5 g NaHCO₃, 100 mg MgSO₄·7H₂O, 5 mg CaCl₂·2H₂O, 1 mg Fe-EDTA per liter (pH 8.0)]30°C, in darkNot applicableSpectrophotometry (600 nm)

YidC-Dependent vs. YidC-Independent Membrane Insertion Characteristics

ProteinTopologyYidC DependencySec DependencyInsertion MechanismEffect of YidCReference
Pf3 coat proteinSingle-spanningDependentIndependentYidC-mediatedRequired for efficient insertion
Pf3 coat mutant (extended hydrophobic region)Single-spanningIndependentIndependentSpontaneousAccelerates insertion
LacY12 transmembrane α-helicesDependentDependentCooperative Sec-YidCPrevents misfolding, stabilizes unfolded state, guides stepwise insertion
MelBPolytopicCan insert without Sec if YidC presentCan be independentYidC-mediatedAccelerates and chaperones stepwise insertion and folding

What emerging technologies could advance our understanding of YidC function?

Several emerging technologies could significantly advance YidC research:

  • Cryo-electron microscopy: High-resolution structural analysis of YidC in complex with substrate proteins at different stages of insertion could provide crucial insights into the mechanism of insertion.

  • Time-resolved structural methods: Techniques such as time-resolved X-ray crystallography or time-resolved cryo-EM could capture the dynamic process of YidC-mediated insertion.

  • Advanced single-molecule techniques: Further development of SMFS combined with fluorescence approaches could allow simultaneous monitoring of force application and conformational changes during membrane protein insertion.

  • Artificial intelligence and molecular dynamics: Enhanced computational approaches could help predict YidC-substrate interactions and simulate the insertion process at atomic resolution.

  • In-cell structural biology: Techniques that allow structural determination within living cells could reveal how YidC functions in its native environment.

  • Systems biology approaches: Large-scale proteomics and transcriptomics in YidC-depleted versus wild-type cells across different bacterial species could identify the complete set of YidC substrates and regulatory networks.

  • CRISPR-based technologies: Precise genome editing could facilitate the creation of conditional YidC variants in diverse bacterial species, including N. europaea, to study organism-specific functions.

How might understanding YidC function contribute to biotechnological applications?

Understanding YidC function could enable several biotechnological applications:

  • Improved membrane protein expression systems: Engineered YidC variants or expression systems with optimized YidC activity could enhance the production of difficult-to-express membrane proteins for structural and functional studies.

  • Synthetic biology applications: Designed YidC-based insertion systems could facilitate the incorporation of non-natural membrane proteins or protein-based materials into synthetic membranes.

  • Antimicrobial development: As YidC is essential in many bacteria and differs from its eukaryotic homologs, it represents a potential target for novel antimicrobials. Understanding its mechanism could aid in rational drug design.

  • Bioremediation enhancements: For organisms like N. europaea that play roles in nitrogen cycling and wastewater treatment , optimizing membrane protein insertion through YidC engineering could potentially enhance their bioremediation capabilities.

  • Protein engineering: Knowledge of how YidC facilitates membrane protein folding could inform the design of more stable or functionally enhanced membrane proteins for biotechnological applications.

  • Cell-free protein synthesis systems: Incorporating YidC into cell-free systems could improve the production of functional membrane proteins for various applications including biosensors and drug screening platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.