Recombinant Nitrosomonas europaea Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Characteristics of Nitrosomonas europaea

N. europaea possesses a circular chromosome consisting of 2,812,094 base pairs . The genome contains approximately 2,460 protein-encoding genes with an average length of 1,011 base pairs, while the intergenic regions average 117 base pairs . Genes are distributed evenly around the genome, with approximately 47% transcribed from one strand and 53% from the complementary strand .

N. europaea can assimilate ammonia via glutamate dehydrogenase, which is consistent with the presence of a gene coding for an NADPH-specific glutamate dehydrogenase . When grown under oxygen-limited conditions, N. europaea exhibits reduced growth yield, and the conversion of ammonia to nitrite is non-stoichiometric, which suggests the production of nitrogenous gases .

MtgA Function and Significance

MtgA is involved in peptidoglycan biosynthesis, a process essential for bacterial cell wall synthesis and integrity . Peptidoglycan transglycosylases catalyze the glycosidic bond formation between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan synthesis .

Role in Nitrogen Cycle

N. europaea plays a critical role in the biogeochemical nitrogen cycle by oxidizing ammonia to nitrite . This process, called nitrification, is essential for converting ammonia from organic waste and fertilizers into forms of nitrogen that plants can use .

Regulation of CO₂ Fixation

Under CO₂-limited conditions, the transcription of RuBisCO-encoding genes in N. europaea increases significantly . N. europaea appears to regulate CO₂ fixation at the level of RuBisCO enzyme concentration due to the absence of carboxysomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; NE1628; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
mtgA
Target Protein Sequence
MKLAQARRPATSKPRLISTWLLRPLLLLLTAALLYQSWFLLHIVYWRSYSPTTSAFMQDR LKIMRQQNPAASLQHQWVDYEQISSHLKRAVIAAEDARFLQHQGFDYKAIETAWKKNLKQ RKWAAGGSTISQQLAKNLFLSTEKTVWRKSRETLITLMLEEFLTKRRILEIYLNIIEWGD GIFGIEAAARHYFGISAASLTPAQAAWLASIIPNPRFYDTRRTLPKLLNKSRIILSRLPA AKIP
Uniprot No.

Target Background

Function
Recombinant *Nitrosomonas europaea* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: neu:NE1628

STRING: 228410.NE1628

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the primary function of mtgA in Nitrosomonas europaea cell physiology?

The primary function of mtgA in N. europaea is to catalyze the polymerization of lipid II precursors to form the glycan strands of peptidoglycan, a critical component of the bacterial cell wall. As a monofunctional transglycosylase, mtgA exclusively performs the glycosyltransferase reaction without the peptide cross-linking activity found in bifunctional penicillin-binding proteins.

In N. europaea, which is an obligate chemolithoautotroph that derives all its energy from ammonia oxidation, proper cell wall integrity is particularly crucial. The bacterium operates in environments with potentially toxic levels of intermediates (like hydroxylamine and nitrite) produced during ammonia oxidation, and a robust cell wall is essential for maintaining cellular integrity under these conditions .

The specialized metabolism of N. europaea, which includes the production of reactive nitrogen species such as nitric oxide (NO) during nitrification, suggests that its cell wall components, including those synthesized through mtgA activity, may have adaptations to withstand these potentially damaging molecules .

What are the optimal conditions for expressing recombinant N. europaea mtgA?

For optimal expression of recombinant N. europaea mtgA, researchers should consider several critical methodological factors:

  • Expression system selection: While the search results don't specify a particular expression system, heterologous expression in E. coli is commonly used for bacterial proteins. Consider BL21(DE3) or similar strains designed for recombinant protein expression.

  • Vector design considerations:

    • Include an appropriate tag for purification (His, GST, etc.)

    • Consider codon optimization for the expression host

    • Evaluate the need for signal sequences if membrane localization is desired

    • Test both N-terminal and C-terminal tag placements to determine optimal activity

  • Expression conditions:

    • Induction parameters: typically IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)

    • Media composition: rich media (LB) for high biomass or minimal media for controlled expression

    • Consider lower temperatures (16-25°C) during induction to enhance proper folding of membrane-associated proteins

  • Cell lysis and extraction:

    • For membrane-associated proteins like mtgA, include appropriate detergents in extraction buffers

    • Consider mechanical disruption methods (sonication, French press) combined with enzymatic treatment

A systematic optimization approach, varying these parameters and assessing protein yield and activity, is recommended to determine conditions specific to N. europaea mtgA .

What purification strategy yields the highest activity for recombinant mtgA?

A multi-step purification strategy is typically required to obtain high-activity preparations of recombinant N. europaea mtgA:

  • Initial capture using affinity chromatography:

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins

    • Careful optimization of imidazole concentration in washing and elution buffers to minimize non-specific binding while maximizing target protein recovery

  • Intermediate purification:

    • Ion exchange chromatography based on the theoretical pI of mtgA

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Activity preservation considerations:

    • Maintain appropriate buffer conditions (pH 7.0-8.0) throughout purification

    • Include glycerol (10-20%) to stabilize the protein

    • Consider adding reducing agents to prevent oxidation of cysteine residues

  • Quality assessment:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Activity assays at each purification step to track specific activity

    • Dynamic light scattering to assess aggregation state

Throughout purification, samples should be handled at 4°C to minimize degradation, and protease inhibitors should be included in buffers when appropriate .

What are the recommended storage conditions for maintaining mtgA activity long-term?

Based on the product information provided, the following storage conditions are recommended for maintaining the activity of recombinant N. europaea mtgA:

  • Short-term storage (up to one week):

    • Temperature: 4°C

    • Buffer: Tris-based buffer at physiological pH

  • Medium-term storage:

    • Temperature: -20°C

    • Buffer: Tris-based buffer with 50% glycerol

  • Long-term storage:

    • Temperature: -80°C

    • Buffer: Same as medium-term storage

Important methodological considerations include:

  • Aliquoting the protein before freezing to avoid repeated freeze-thaw cycles

  • Quick-freezing in liquid nitrogen before transferring to -80°C

  • Thawing samples on ice when needed for experiments

  • Avoiding repeated freezing and thawing, which significantly reduces enzyme activity

For research applications requiring extended storage periods, lyophilization may be considered, though this would require additional optimization and validation of activity recovery .

How can transglycosylase activity of recombinant mtgA be measured in vitro?

Several methodological approaches can be employed to measure the transglycosylase activity of recombinant N. europaea mtgA:

  • Radiolabeled substrate assays:

    • Using [14C] or [3H]-labeled lipid II substrate

    • Measuring incorporation into high molecular weight peptidoglycan

    • Separation by paper chromatography or SDS-PAGE followed by scintillation counting

    • Advantages: high sensitivity; disadvantages: requires radioisotope handling facilities

  • Fluorescent substrate assays:

    • Using dansylated or BODIPY-labeled lipid II analogs

    • Monitoring fluorescence changes upon polymerization

    • Real-time detection of product formation using fluorescence plate readers

    • Advantages: real-time kinetics; disadvantages: potential interference of fluorophores with enzyme activity

  • HPLC-based analytical methods:

    • Separation of reaction products based on size

    • Detection of both substrate consumption and product formation

    • Quantitative analysis of reaction kinetics

    • Advantages: detailed product analysis; disadvantages: more time-consuming than spectroscopic methods

A typical protocol would include:

  • Preparation of lipid II substrate (natural or synthetic)

  • Reaction buffer containing detergent micelles or liposomes

  • Defined reaction conditions (pH, temperature, ionic strength)

  • Time-course sampling followed by reaction termination

  • Analysis of products by the selected detection method

The choice of method depends on available equipment, required sensitivity, and whether endpoint or kinetic data are needed .

How can mtgA function be studied in the context of N. europaea's specialized metabolism?

Studying mtgA function in the context of N. europaea's specialized ammonia-oxidizing metabolism requires integrated experimental approaches:

  • Correlation with nitrification pathways:

    • N. europaea derives all its energy from ammonia oxidation, producing hydroxylamine, nitrite, and nitric oxide as intermediates

    • Experimental designs should evaluate mtgA activity under varying ammonia concentrations and oxygen availability

    • Measuring cell wall integrity during active nitrification provides insights into mtgA's role in cellular protection

  • Integration with nitrogen oxide metabolism:

    • N. europaea possesses a complex network for handling reactive nitrogen species

    • The norCBQD gene cluster (encoding nitric oxide reductase) and hydroxylamine oxidoreductase operate alongside cell wall synthesis pathways

    • Co-immunoprecipitation or bacterial two-hybrid assays can identify potential interactions between mtgA and nitrogen metabolism proteins

  • Methodological approaches:

    • Generation of mtgA knockout or conditional expression strains

    • Fluorescent labeling of peptidoglycan to track synthesis during different metabolic states

    • Transcriptomic analysis to identify co-regulated genes in response to environmental changes

The relationship between cell wall synthesis and ammonia oxidation in N. europaea represents an important area for understanding how this specialized bacterium has adapted its basic cellular processes to its ecological niche .

What experimental designs can reveal the spatial localization and dynamics of mtgA in living cells?

Advanced imaging and labeling techniques can be employed to study the spatial localization and dynamics of mtgA in living N. europaea cells:

  • Fluorescent protein fusion constructs:

    • Creating mtgA-GFP or mtgA-mCherry fusion proteins

    • Careful design to preserve protein function (typically C-terminal fusions)

    • Expression from native promoters to maintain physiological levels

    • Time-lapse microscopy to track localization throughout the cell cycle

  • Super-resolution microscopy approaches:

    • Structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM)

    • Resolution below the diffraction limit to precisely locate mtgA at the cell membrane

    • Co-localization with other cell wall synthesis proteins

  • Nascent peptidoglycan labeling:

    • Fluorescent D-amino acids (FDAAs) to label sites of active peptidoglycan synthesis

    • Click chemistry-compatible amino acids for pulse-chase experiments

    • Correlation of synthesis sites with mtgA localization

  • Experimental design considerations:

    • Growth conditions mimicking environmental niches of N. europaea

    • Synchronization methods to observe cell cycle-dependent localization

    • Microfluidic devices for precise control of environmental conditions during imaging

These approaches allow for connecting mtgA's biochemical function to its cellular context, providing insights into how peptidoglycan synthesis is spatially and temporally regulated in N. europaea .

How can site-directed mutagenesis of mtgA inform structure-function relationships?

Site-directed mutagenesis of N. europaea mtgA can provide critical insights into structure-function relationships through systematic experiments:

  • Target residue selection strategy:

    • Focus on conserved residues in the catalytic domain (particularly the GIFGIEAA motif)

    • Target membrane-interacting regions to understand localization requirements

    • Investigate species-specific residues that differ from other bacterial mtgA proteins

  • Experimental design approach:

    • Generate a panel of point mutations (alanine scanning or conservative substitutions)

    • Express and purify each mutant protein under identical conditions

    • Quantitatively assess enzymatic activity using validated assays

    • Determine effects on substrate binding using isothermal titration calorimetry

  • Structural characterization methodologies:

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Thermal shift assays to evaluate protein stability

    • X-ray crystallography or cryo-EM for selected mutants to visualize structural impacts

  • Data analysis framework:

    • Correlation of activity changes with structural predictions

    • Mapping of mutation effects onto homology models

    • Classification of residues as catalytic, substrate-binding, or structurally important

Such systematic mutagenesis studies can elucidate the molecular basis of transglycosylase activity and identify potential targets for inhibitor design or protein engineering .

How can recombinant mtgA be utilized to study bacterial cell wall biosynthesis inhibitors?

Recombinant N. europaea mtgA provides a valuable tool for studying cell wall biosynthesis inhibitors through several methodological approaches:

  • High-throughput screening assays:

    • Development of fluorescence-based activity assays in 96 or 384-well formats

    • Screening of natural product libraries or synthetic compound collections

    • Structure-activity relationship studies on identified inhibitors

  • Mechanism of action studies:

    • Enzyme kinetics in presence of inhibitors (competitive, non-competitive, uncompetitive)

    • Binding studies using surface plasmon resonance or microscale thermophoresis

    • X-ray crystallography of enzyme-inhibitor complexes

  • Comparative inhibition analysis:

    • Testing inhibitor efficacy against mtgA from different bacterial species

    • Identifying species-selective inhibitors based on structural differences

    • Understanding the molecular basis of selectivity

  • Validation in cellular systems:

    • Correlation of in vitro inhibition with effects on whole cells

    • Peptidoglycan analysis following inhibitor treatment

    • Synergy testing with other cell wall-targeting agents

This research direction has implications for both fundamental understanding of cell wall synthesis and potential development of new antimicrobial strategies targeting bacteria with similar transglycosylase enzymes .

How might mtgA function be integrated with other cellular processes in systems biology approaches?

Systems biology approaches can reveal how mtgA function integrates with broader cellular processes in N. europaea:

  • Multi-omics integration methodology:

    • Transcriptomic analysis to identify genes co-regulated with mtgA

    • Proteomic studies to map the cell wall synthesis interactome

    • Metabolomic profiling of peptidoglycan precursors and intermediates

    • Integration of datasets using computational modeling

  • Network analysis approach:

    • Construction of gene regulatory networks centered on cell wall synthesis

    • Identification of hub proteins connecting mtgA function to other cellular processes

    • Prediction of system-wide effects of mtgA perturbation

  • Experimental validation strategies:

    • Controlled expression systems to modulate mtgA levels

    • Quantitative phenotyping under diverse environmental conditions

    • Chemical genetic approaches to simultaneously perturb multiple pathways

  • Mathematical modeling framework:

    • Kinetic models of peptidoglycan synthesis incorporating mtgA activity

    • Flux balance analysis to predict metabolic consequences of altered cell wall synthesis

    • Agent-based models of cell growth incorporating mechanical properties of peptidoglycan

This systems-level understanding would provide insights into how N. europaea has integrated fundamental processes like cell wall synthesis with its specialized ammonia-oxidizing metabolism, potentially revealing adaptations that enable this bacterium to thrive in its ecological niche .

What approaches can be used to study the role of mtgA in N. europaea interactions with other microorganisms in ecological contexts?

Investigating the role of mtgA in N. europaea's ecological interactions requires specialized experimental approaches:

  • Co-culture methodologies:

    • Controlled laboratory co-cultures with denitrifying bacteria like Paracoccus denitrificans

    • Spatial organization in structured environments (biofilms, aggregates)

    • Distribution analysis using fluorescence in situ hybridization (FISH)

  • Synthetic ecology approaches:

    • Construction of defined microbial consortia with varying mtgA expression

    • Tubular gel systems allowing spatial separation of different bacterial populations

    • Manipulation of electron donors (ethanol vs. hydrogen) to alter spatial distribution

  • Analytical techniques:

    • Microscopic investigation using fluorescently-labeled antibodies

    • Quantitative distribution density assessment from photomicrographs

    • Measurement of nitrification rates in mixed communities

  • Experimental findings from model systems:

    • In tubular gel systems, the distribution of N. europaea can be manipulated to separate from other bacteria like P. denitrificans

    • When hydrogen is used as electron donor instead of ethanol, N. europaea and P. denitrificans distributions become distinct

    • This separation can increase ammonia oxidation rates by up to 25%

These approaches can help understand how cell wall properties, influenced by mtgA activity, affect N. europaea's interactions in complex microbial communities involved in nitrogen cycling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.