Recombinant Nitrosomonas europaea Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Recombinant NqrE from N. europaea (UniProt ID Q82SE7) is produced in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
Host OrganismEscherichia coli
TagN-terminal His tag
Amino Acid Range1–202 aa (full-length)
Molecular FunctionElectron transfer, Fe-S cluster stabilization
RelevanceCritical for Na+-NQR assembly and activity

This recombinant protein enables biochemical studies, such as probing Fe-S cluster assembly mechanisms and subunit interactions .

Role in Na+-NQR Maturation

Functional Na+-NQR requires maturation factors like ApbE (flavin transferase) and NqrM (Fe delivery) . While recombinant NqrE alone lacks enzymatic activity, co-expression with these factors in heterologous systems (e.g., E. coli) restores Na+-NQR functionality . In Vibrio harveyi, NqrM-deficient strains produce incomplete Na+-NQR complexes missing NqrE and other subunits , underscoring NqrM’s role in stabilizing NqrE during assembly.

Research Applications

  • Drug Targeting: Na+-NQR is absent in humans but vital for pathogens like Vibrio cholerae and Yersinia pestis. Recombinant NqrE facilitates inhibitor screening to disrupt bacterial Na+ homeostasis .

  • Metabolic Engineering: Studies on N. europaea’s respiratory chain—including NqrE—inform bioenergy applications, such as optimizing ammonia oxidation pathways .

Unresolved Questions

  • Fe-S Cluster Assembly: The exact mechanism of Fe delivery to NqrE by NqrM remains unclear .

  • Regulatory Interactions: How NqrE coordinates with other subunits (e.g., NqrF’s FAD domain) during electron transport requires further structural analysis .

Comparative Analysis of Na+-NQR Subunits

SubunitFunctionMaturation Dependency
NqrEFe-S cluster coordinationRequires NqrM
NqrFNADH oxidation via FADRequires ApbE
NqrB/C/DUbiquinone binding, ion translocationDependent on NqrM/ApbE

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. Please specify your desired tag type for prioritized development.
Synonyms
nqrE; NE2393; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
nqrE
Target Protein Sequence
MNSLAGLFITAVFVENLALTFFLGMCTFLAISKKIEVAFGMGIAVIVVQTLTVPINNLVY QYLLRDGALVWAGLAEIDLTFLGLVSYLGVIAAIVQILEMFLDRFMPALHSALGIYLPLI AVNCAILGGSLFMVERDYNFTESLVYGLGSGFGWALAIVALAGVRERLKYSDVPDGLQGL GITFISAGLMAMGFMAFSGIRL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Database Links

KEGG: neu:NE2393

STRING: 228410.NE2393

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase (Na(+)-NQR) complex and what is its significance in Nitrosomonas europaea?

Na(+)-translocating NADH:quinone oxidoreductase (Na(+)-NQR) is a respiratory complex that catalyzes electron transfer from NADH to ubiquinone in the bacterial respiratory chain, coupled with Na(+) translocation across the membrane . Though most extensively studied in pathogenic bacteria like Vibrio species, this enzyme complex is believed to enhance bacterial vitality in various organisms including Nitrosomonas europaea . In N. europaea, this complex would function alongside other respiratory components like the NorCBQD (nitric oxide reductase) system, potentially providing metabolic flexibility during shifts in oxygen availability and contributing to energy conservation during ammonia oxidation .

How does the Na(+)-NQR complex differ from other respiratory complexes in N. europaea?

Unlike the nitric oxide reductase (NorCBQD) which is involved in denitrification pathways and is expressed even under aerobic conditions in N. europaea , the Na(+)-NQR complex serves as a primary sodium pump that couples NADH oxidation to Na(+) translocation. The Na(+)-NQR complex contains unique features including covalently bound FMN residues and a distinctive (Cys)4[Fe] center between subunits NqrD and NqrE . This significantly differs from the heme-containing NorCB complex, which catalyzes the reduction of nitric oxide to nitrous oxide in the denitrification pathway . While N. europaea employs various nitrogen oxide-processing enzymes during nitrification and nitrifier denitrification (like NirK and NorBC), the Na(+)-NQR system would provide an additional respiratory option particularly advantageous under certain environmental conditions .

What expression systems are most effective for producing recombinant N. europaea nqrE protein?

Based on successful heterologous expression approaches with Na(+)-NQR components from other bacteria, Escherichia coli expression systems utilizing pBAD vectors have proven effective for Na(+)-NQR studies . When expressing nqrE specifically, it's critical to consider that functional expression likely requires co-expression with other components of the Na(+)-NQR complex.

Research with Vibrio harveyi Na(+)-NQR has demonstrated that expressing the entire nqr operon (nqrA-F) in E. coli strain ANN091 (nuoI::Kmr), which is deficient in H(+)-translocating NADH:quinone oxidoreductase (NDH-1), provides an excellent background for characterizing recombinant Na(+)-NQR activity . For N. europaea nqrE, a similar approach would be recommended, with the additional consideration that maturation factors like ApbE and NqrM must be co-expressed to obtain functional protein .

What are the critical co-factors needed for proper folding and function of recombinant nqrE?

Successful expression of functional nqrE requires attention to several critical co-factors:

  • Iron availability: The (Cys)4[Fe] center between nqrD and nqrE requires iron for proper formation .

  • Flavin mononucleotide (FMN): While not directly attached to nqrE, FMN is covalently attached to other Na(+)-NQR subunits and is essential for complex function .

  • Maturation factors: Both ApbE (flavin transferase) and NqrM are required for proper Na(+)-NQR assembly .

A key finding from Vibrio harveyi research indicates that NqrM, which contains four conserved cysteine residues, may be specifically involved in delivering iron to form the (Cys)4[Fe] center between nqrD and nqrE subunits . Mutation studies revealed that changing one specific cysteine residue (Cys33 in V. harveyi NqrM) to serine completely prevented Na(+)-NQR maturation, while mutations at other cysteine positions only decreased protein yield . This suggests that similar considerations would apply when expressing recombinant N. europaea nqrE.

What purification methods yield the highest activity for recombinant nqrE protein?

Based on successful purification of Na(+)-NQR complexes from other bacterial species, a multi-step purification approach is recommended:

  • Membrane isolation: Since nqrE is a membrane-associated protein, initial purification requires careful membrane preparation from expressing cells.

  • Detergent solubilization: Gentle detergents such as DDM (n-dodecyl β-D-maltoside) are typically effective for solubilizing Na(+)-NQR components without denaturing them.

  • Affinity chromatography: Using histidine-tagged constructs can facilitate purification if tags are placed at positions that don't interfere with complex assembly.

  • Size exclusion chromatography: This final step helps isolate intact complexes of appropriate size.

Activity measurements can be performed using spectrophotometric assays that follow NADH or dNADH oxidation at 340 nm, with specific Na(+)-dependent activity attributed to functional Na(+)-NQR complexes containing properly assembled nqrE . When purifying from heterologous systems, it's essential to confirm that all necessary maturation factors (ApbE and NqrM) are co-expressed to obtain functional protein .

How do mutations in conserved cysteine residues of nqrE affect the assembly and function of the Na(+)-NQR complex?

Extrapolating from studies on related Na(+)-NQR systems, mutations in the conserved cysteine residues of nqrE would likely disrupt the formation of the (Cys)4[Fe] center that bridges nqrD and nqrE subunits . This iron center is crucial for electron transfer within the complex. Research on the maturation factor NqrM has shown that conserved cysteine residues play differential roles in Na(+)-NQR assembly, with some being absolutely essential (like Cys33 in V. harveyi NqrM) and others having partial effects on complex yield .

For experimental analysis of cysteine mutations in N. europaea nqrE, site-directed mutagenesis could be employed to systematically replace each conserved cysteine with serine residues. The functional consequences could then be assessed through:

  • Na(+)-dependent NADH oxidation activity measurements

  • Complex assembly analysis via native gel electrophoresis

  • Subunit interaction studies using co-immunoprecipitation

  • Iron content analysis to determine if the Fe center forms properly

What is the effect of oxygen limitation on nqrE expression in N. europaea?

While the search results don't directly address nqrE expression under oxygen limitation in N. europaea, we can extrapolate from related studies on respiratory complexes in this organism. N. europaea shows interesting respiratory adaptations under oxygen-limited conditions, as evidenced by transcriptomic studies .

Under oxygen limitation, N. europaea demonstrates differential regulation of various respiratory components. For instance, the nitrite reductase (nirK) gene shows decreased transcription (4.2-fold reduction) during oxygen limitation, despite its role in nitrifier denitrification . This contrasts with the expression pattern of nirK in many denitrifiers, suggesting unique regulatory mechanisms in N. europaea .

For nqrE expression, research questions would focus on:

  • Whether Na(+)-NQR provides an alternative respiratory pathway during oxygen limitation

  • If the Na(+) gradient generated by Na(+)-NQR might support other cellular processes when oxygen is scarce

  • The potential coordination between Na(+)-NQR and nitric oxide reductase (Nor) expression, given that NorCB-dependent activity in N. europaea is present during aerobic growth and not affected by inactivation of the putative fnr gene

How does the interaction between nqrD and nqrE contribute to the (Cys)4[Fe] center formation?

The formation of the (Cys)4[Fe] center between nqrD and nqrE subunits represents a fascinating aspect of Na(+)-NQR assembly that requires detailed investigation. Based on research on Na(+)-NQR maturation, both subunits likely contribute conserved cysteine residues that coordinate a single iron atom . This unique iron center differs from typical iron-sulfur clusters and plays a crucial role in electron transfer within the complex.

Research approaches to study this interaction could include:

  • Co-expression studies with various combinations of wild-type and mutant nqrD and nqrE subunits

  • Structural analysis using techniques like X-ray crystallography or cryo-electron microscopy

  • Cross-linking experiments to analyze the physical proximity of specific residues

  • Spectroscopic analyses (EPR, Mössbauer) to characterize the electronic properties of the iron center

Understanding this interaction is critical because the maturation factor NqrM is believed to be involved specifically in delivering iron to form this (Cys)4[Fe] center . Research questions would focus on how the nqrD-nqrE interaction creates the appropriate coordination environment for iron binding and how this assembly process is facilitated by maturation factors.

What assays can be used to measure the specific activity of recombinant nqrE within the Na(+)-NQR complex?

Functional analysis of recombinant nqrE within the Na(+)-NQR complex requires specialized assays that can distinguish Na(+)-NQR activity from other NADH oxidation pathways. Based on established methodologies, the following approaches are recommended:

Table 1: Assays for Na(+)-NQR Functional Analysis

Assay TypeMethodologySpecificity for Na(+)-NQRKey Considerations
Na(+)-stimulated dNADH oxidase activitySpectrophotometric measurement at 340 nm in presence vs. absence of Na+High - dNADH specificity eliminates NDH-1 activityRequires HQNO as specific inhibitor for confirmation
dNADH:menadione oxidoreductase activityFollows reduction of menadione coupled to dNADH oxidationGood - measures NADH dehydrogenase activity of Na(+)-NQRLess specific than Na(+)-stimulated assay
HQNO-sensitive NADH oxidationMeasures NADH oxidation sensitive to HQNO inhibitionModerateMay detect other quinone reductases

The reaction medium typically contains 20 mM HEPES-Tris, 5 mM MgSO4, and 50 mM KCl at pH 8.0, with 50 μM menadione added for dehydrogenase activity measurements . For Na(+)-stimulated activity, comparison between buffers containing KCl versus NaCl allows quantification of Na(+)-dependent component. An extinction coefficient (ε340) of 6.22 mM−1 cm−1 can be used for NADH and dNADH quantification .

How can researchers verify the proper assembly of the (Cys)4[Fe] center between nqrD and nqrE?

Verifying the formation of the unique (Cys)4[Fe] center requires specialized spectroscopic and analytical techniques:

  • Iron content analysis: Atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS) can quantify iron content in purified Na(+)-NQR complexes.

  • Electron Paramagnetic Resonance (EPR) spectroscopy: This can characterize the electronic state of the iron center and confirm its coordination environment.

  • UV-visible spectroscopy: The iron center may exhibit characteristic absorption features that can be monitored to assess proper assembly.

  • Functional correlation: Comparing iron content with enzymatic activity can establish structure-function relationships.

  • Site-directed mutagenesis: Systematic mutation of conserved cysteine residues in both nqrD and nqrE followed by activity and spectroscopic analysis can identify which residues participate in iron coordination.

What experimental approaches can distinguish the roles of NqrM and ApbE in nqrE maturation?

Based on research with V. harveyi Na(+)-NQR, both NqrM and ApbE are required for proper Na(+)-NQR maturation, but they serve distinct functions . Experimental approaches to distinguish their specific roles in nqrE maturation include:

  • Complementation studies: Express N. europaea nqr genes in E. coli with different combinations of maturation factors:

    • nqr operon alone

    • nqr operon + apbE

    • nqr operon + nqrM

    • nqr operon + apbE + nqrM

  • Biochemical analysis of partially assembled complexes: Purify Na(+)-NQR from cells expressing different combinations of maturation factors and analyze:

    • Subunit composition by SDS-PAGE

    • FMN content (reflecting ApbE activity)

    • Iron content (reflecting NqrM activity)

    • Enzyme activity

  • Site-directed mutagenesis: Create targeted mutations in:

    • ApbE at residues involved in flavin attachment

    • NqrM at conserved cysteine residues (especially the equivalent of Cys33 in V. harveyi)

Data from V. harveyi studies indicate that ApbE functions as a flavin transferase catalyzing covalent FMN attachment, while NqrM likely facilitates iron delivery for the (Cys)4[Fe] center formation . Mutation of Cys33 in V. harveyi NqrM completely prevented Na(+)-NQR maturation, whereas mutations at other cysteine residues only decreased protein yield .

What are common challenges in obtaining active recombinant N. europaea nqrE and how can they be addressed?

Based on experiences with Na(+)-NQR expression from other bacterial species, several challenges are commonly encountered:

Table 2: Troubleshooting Recombinant nqrE Expression

ChallengePossible CausesSolutions
Low expression levelsToxicity, codon bias, protein instabilityOptimize codon usage, use tightly regulated expression systems, co-express with chaperones
Improper foldingMissing co-factors, lack of maturation factorsCo-express with ApbE and NqrM, supplement growth media with iron
Incomplete complex assemblySubunit stoichiometry imbalanceDesign polycistronic constructs, adjust relative gene expression levels
Low enzymatic activityIncomplete maturation, detergent effectsTest different detergents for membrane extraction, ensure expression of all maturation factors
Protein aggregationHydrophobic transmembrane domainsUse solubility tags, optimize detergent concentration

Research with V. harveyi Na(+)-NQR demonstrated that expression of the nqr operon alone, or even with ApbE, was insufficient for producing functional enzyme . Only when NqrM was also co-expressed was fully functional Na(+)-NQR obtained . This highlights the absolute requirement for both maturation factors when expressing recombinant Na(+)-NQR components.

How do environmental conditions influence the stability and activity of recombinant nqrE?

Several environmental factors critically influence nqrE stability and function:

  • pH: Na(+)-NQR activity assays are typically performed at pH 8.0 , suggesting this is optimal for enzyme function. Significant deviations from this pH may destabilize the complex or alter ionization states of critical residues.

  • Salt concentration: As a Na(+)-translocating enzyme, the complex is sensitive to Na(+) concentration. Optimal conditions typically include 50 mM salt (KCl for basal measurements, NaCl for Na(+)-stimulated activity) .

  • Temperature: While mesophilic bacteria like N. europaea typically have enzymes optimized around 30°C, stability during purification may be improved at lower temperatures.

  • Redox environment: The (Cys)4[Fe] center and other redox-active cofactors are sensitive to oxidation. Maintaining an appropriate redox environment with mild reducing agents may be crucial for preserving activity.

  • Detergent selection: Membrane proteins like nqrE are sensitive to the type and concentration of detergents used during purification. Different detergents vary in their ability to maintain native protein conformation and activity.

Optimization of these conditions through systematic testing is essential for obtaining reproducible results with recombinant nqrE.

How does the Na(+)-NQR system interact with other respiratory complexes in N. europaea?

N. europaea possesses a complex respiratory network that includes ammonia oxidation, nitrifier denitrification, and potentially Na(+)-dependent respiration. Understanding the interactions between these systems presents important research questions:

  • Coordination with norCBQD: N. europaea expresses a functional nitric oxide reductase (Nor) encoded by the norCBQD gene cluster even under aerobic conditions . This suggests potential coordination between different respiratory pathways. Research has shown that NorB-deficient cells still produce normal amounts of N2O, indicating alternative sites of N2O production . The relationship between Na(+)-NQR and these alternative respiratory pathways remains an important area for investigation.

  • Electron flow distribution: Under different environmental conditions, electron flow may be partitioned differently between Na(+)-NQR and other respiratory complexes. Methods to investigate this include:

    • Inhibitor studies with specific inhibitors for different complexes

    • Membrane potential measurements under various conditions

    • Transcriptomic and proteomic analysis in response to environmental shifts

  • Respiratory flexibility: The presence of multiple respiratory options (including Na(+)-NQR) may provide N. europaea with metabolic flexibility when adapting to changing environments. Understanding how the bacterium regulates these different pathways represents an important research direction.

What role might Na(+)-NQR play in N. europaea's adaptation to different environmental conditions?

N. europaea demonstrates remarkable adaptability to changing environmental conditions, including shifts in oxygen availability . The Na(+)-NQR system may contribute significantly to this adaptability:

  • Response to oxygen limitation: Under oxygen-limited conditions, N. europaea shows differential expression of various respiratory genes . While the search results don't specifically address nqrE regulation, the Na(+)-NQR system might serve as an alternative respiratory option when oxygen becomes limiting.

  • pH adaptation: As an ammonia-oxidizing bacterium, N. europaea must contend with potential pH changes in its environment. The Na(+) gradient established by Na(+)-NQR might contribute to pH homeostasis under certain conditions.

  • Energy conservation: Na(+)-NQR couples NADH oxidation to Na(+) pumping, which potentially enables energy conservation through secondary transporters that utilize the Na(+) gradient. This could provide metabolic advantages under energy-limited conditions.

Research approaches to address these questions include:

  • Comparative growth studies of wild-type and Na(+)-NQR-deficient strains under various environmental challenges

  • Measurement of Na(+)/H(+) gradients under different growth conditions

  • Transcriptomic and proteomic profiling in response to environmental shifts

What emerging technologies might advance understanding of nqrE structure and function?

Several cutting-edge technologies hold promise for deeper insights into nqrE structure and function:

  • Cryo-electron microscopy: Recent advances in cryo-EM have revolutionized membrane protein structural biology. This approach could potentially reveal the detailed structure of the Na(+)-NQR complex, including the arrangement of nqrE and its interactions with other subunits.

  • Single-molecule techniques: Methods like single-molecule FRET could provide insights into conformational changes during the catalytic cycle, potentially revealing how Na(+) translocation is coupled to electron transfer.

  • Native mass spectrometry: This emerging technique allows analysis of intact membrane protein complexes, potentially revealing subunit stoichiometry and cofactor binding.

  • Time-resolved spectroscopy: Advanced spectroscopic methods could track electron transfer through the Na(+)-NQR complex in real-time, elucidating the role of the (Cys)4[Fe] center in this process.

  • Computational approaches: Molecular dynamics simulations and quantum mechanical calculations could model the (Cys)4[Fe] center and predict how mutations might affect its properties.

These technologies, applied to recombinant N. europaea Na(+)-NQR, would significantly advance our understanding of this complex respiratory enzyme.

How might comparative studies with Na(+)-NQR from other bacteria inform research on N. europaea nqrE?

Comparative analysis between Na(+)-NQR systems from different bacterial species offers valuable research opportunities:

  • Evolutionary insights: Comparing nqrE sequences across species could reveal conserved functional regions versus adaptations specific to the N. europaea lifestyle.

  • Functional conservation: Na(+)-NQR has been well-studied in pathogens like Vibrio species . Determining whether functional properties are conserved in N. europaea would inform both basic science and potential applications.

  • Maturation requirements: Research has shown that Na(+)-NQR maturation in V. harveyi requires both ApbE and NqrM . Investigating whether N. europaea Na(+)-NQR has similar or distinct maturation requirements would be valuable.

  • Structural variations: Comparing the (Cys)4[Fe] center properties between species could reveal how this unique cofactor has been optimized for different ecological niches.

Such comparative approaches would place N. europaea Na(+)-NQR research in a broader context and potentially reveal adaptations specific to ammonia-oxidizing bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.