Recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nitrosomonas europaea NADH-Quinone Oxidoreductase Subunit A (nuoA)

Recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit A (nuoA) is a protein derived from the bacterium Nitrosomonas europaea, which is a well-studied ammonia-oxidizing bacterium. This protein is part of the NADH dehydrogenase complex I, also known as NDH-1, which plays a crucial role in the respiratory chain of bacteria by facilitating electron transfer from NADH to ubiquinone. The recombinant version of this protein is produced through genetic engineering techniques, typically expressed in Escherichia coli and often tagged with a His-tag for purification purposes .

Function and Importance

NADH-quinone oxidoreductase is essential for the bacterial respiratory chain, contributing to energy production through the transfer of electrons. In Nitrosomonas europaea, this enzyme is vital for maintaining cellular energy homeostasis, especially during ammonia oxidation processes. The subunit A (nuoA) is one of the several subunits that make up the complex and is crucial for its stability and function .

Production and Characteristics

The recombinant full-length Nitrosomonas europaea NADH-quinone oxidoreductase subunit A (nuoA) protein is typically produced in Escherichia coli and is available with a His-tag for easy purification. The protein has a purity of greater than 90% as determined by SDS-PAGE . The amino acid sequence of nuoA spans 1-122 amino acids and is identified by the UniProt accession number Q82TU3 .

Research Applications

Recombinant nuoA proteins are used in various research applications, including studies on bacterial respiration, protein structure-function relationships, and the development of diagnostic tools. For instance, ELISA kits are available for detecting this protein, which can be useful in immunological studies or for monitoring protein expression levels .

Data and Research Findings

While specific data on the recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit A (nuoA) is limited, studies on similar proteins in other bacteria provide insights into their roles and functions. For example, the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) in other bacteria involves complex assembly processes that require specific maturation factors like NqrM .

Table 1: Characteristics of Recombinant Nitrosomonas europaea NADH-Quinone Oxidoreductase Subunit A (nuoA)

CharacteristicsDescription
Expression HostEscherichia coli
TagHis-tagged
Purity>90% (SDS-PAGE)
Amino Acid Sequence1-122 amino acids
UniProt AccessionQ82TU3

Table 2: Comparison with Other NADH-Quinone Oxidoreductases

EnzymeFunctionSubunitsRole in Bacteria
NDH-1Electron transfer from NADH to ubiquinoneMultiple subunitsEnergy production in respiratory chain
Na+-NQRElectron transfer coupled with Na+ translocationSix subunitsEnergy production and Na+ pumping in certain bacteria
NDH-2Electron transfer from NADH to ubiquinoneSingle subunitEnergy production without proton pumping

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If a specific tag type is required, please inform us during the ordering process, and we will prioritize its inclusion.
Synonyms
nuoA; NE1777; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
nuoA
Target Protein Sequence
MLNTMLGNYFPILLFILVGLAIGVLSMLAGWLLAPNKPDAEKLSPYECGFGAFEDARMKF DVRYYLIAILFILFDLEIAFLFPWAVVLKEIGWFGFVAMLVFLGLLVVGFIYEWVKGALE WD
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Database Links

KEGG: neu:NE1777

STRING: 228410.NE1777

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase subunit A (nuoA) in Nitrosomonas europaea?

NuoA is a membrane-embedded subunit of Complex I (NADH:ubiquinone oxidoreductase) in the respiratory chain of Nitrosomonas europaea, an obligate chemolithoautotroph that derives all its energy from ammonia oxidation . The protein functions as part of the proton-pumping machinery that couples electron transfer from NADH to ubiquinone with proton translocation across the membrane, contributing to the establishment of a proton gradient used for ATP synthesis . In N. europaea specifically, this respiratory complex plays a crucial role in the bacterium's energy metabolism, which is specialized for ammonia oxidation as part of the nitrogen cycle.

How is nuoA structurally integrated into the Complex I architecture?

NuoA represents one of the 13 distinct subunits (NuoA-N) that constitute the complete NADH:ubiquinone oxidoreductase complex in bacteria . The protein is a membrane-embedded component positioned in the hydrophobic domain of Complex I. Current structural models indicate that nuoA spans the membrane with multiple transmembrane helices, interacting closely with other membrane subunits like nuoH, nuoJ, and nuoK to form the proton translocation pathway. The arrangement of these subunits creates conformational changes during electron transfer that drive proton pumping across the membrane . This positioning is critical for coupling electron transport to proton translocation.

What distinguishes Nitrosomonas europaea nuoA from homologous proteins in other bacteria?

Nitrosomonas europaea nuoA shows specific adaptations related to the organism's specialized metabolism as an ammonia oxidizer. While the core structure maintains conservation with other bacterial nuoA proteins, sequence analysis reveals unique residues that may facilitate interaction with other components of N. europaea's respiratory chain . Unlike many heterotrophic bacteria, N. europaea has a more limited number of terminal oxidases and electron transport pathways, with only one type of terminal oxidase of the aa3 family identified in its genome . This suggests that nuoA in N. europaea functions within a more specialized electron transport chain compared to organisms with more diverse metabolic capabilities.

What expression systems are most effective for producing recombinant N. europaea nuoA?

For successful expression of recombinant N. europaea nuoA, E. coli-based systems with controlled induction mechanisms have proven most effective. The optimal approach involves cloning the nuoA gene under the control of an inducible promoter such as ParaBAD (arabinose-inducible) in expression vectors designed for membrane proteins . When expressing nuoA individually, it's essential to include a strong ribosome binding site and codon optimization for the host. For functional studies, co-expression with other Complex I subunits may be necessary, potentially using a construct similar to the lambda Red-mediated approach used for E. coli Complex I . Expression should be conducted at lower temperatures (16-20°C) post-induction to facilitate proper membrane insertion and folding.

What are the critical parameters for purifying recombinant nuoA while maintaining native conformation?

Purification of recombinant nuoA requires careful consideration of detergent selection and buffer composition to maintain protein stability and native conformation. Based on established methods for Complex I components, dodecyl maltoside (DDM) is recommended as the primary detergent for solubilization . The purification protocol should include:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization with 1% DDM in buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, and 5% glycerol

  • Immobilized metal affinity chromatography using Ni²⁺-iminodiacetic acid matrix for His-tagged constructs

  • Size exclusion chromatography to ensure monodispersity

Critical parameters include maintaining the pH between 7.0-7.5, keeping temperatures below 4°C throughout purification, and including lipids (0.01-0.05% phospholipids) in later purification stages to stabilize the protein . The addition of protease inhibitors and reducing agents is essential to prevent degradation and oxidation.

How can researchers verify the structural integrity of purified recombinant nuoA?

Verification of structural integrity for purified recombinant nuoA involves multiple complementary approaches:

  • SDS-PAGE analysis: Should show a single band at the expected molecular weight (~17-19 kDa for nuoA)

  • Western blotting: Using anti-His antibodies for tagged constructs or custom antibodies against nuoA epitopes

  • Mass spectrometry: For precise mass determination and verification of post-translational modifications

  • Circular dichroism (CD) spectroscopy: To assess secondary structure composition, particularly the alpha-helical content expected from transmembrane domains

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): To confirm homogeneity and proper oligomeric state

  • Limited proteolysis: To evaluate the compactness and folding of the purified protein

Additionally, reconstitution into proteoliposomes followed by functional assays provides the ultimate verification that the protein maintains its native conformation capable of participating in proton translocation .

What methods are available for assessing the electron transfer function of recombinant nuoA in vitro?

Assessing electron transfer function involving recombinant nuoA requires reconstitution approaches to restore the protein's native environment. Although nuoA alone cannot catalyze complete electron transfer, researchers can evaluate its contribution using these methods:

  • Reconstitution of nuoA with other Complex I subunits in proteoliposomes, following protocols established for E. coli Complex I

  • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors like decylubiquinone

  • Monitoring NADH oxidation spectrophotometrically at 340 nm in the presence of reconstituted complexes

  • Measuring proton translocation using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine)

  • Electron paramagnetic resonance (EPR) spectroscopy to track the redox states of iron-sulfur clusters in the assembled complex

For nuoA-specific contributions, comparing activities between wildtype assemblies and those with modified or deleted nuoA provides insight into its role in electron transfer and proton pumping efficiency .

How does nuoA contribute to proton translocation in the complete Complex I?

NuoA contributes to proton translocation in Complex I through its transmembrane helices that form part of the proton channel within the membrane domain. Current models derived from related bacterial complexes suggest that nuoA participates in a conformational change cascade that couples electron transfer at the peripheral arm to proton movement through the membrane domain . Key charged residues in nuoA's transmembrane segments likely form part of the proton translocation pathway.

The mechanism involves:

  • Electron transfer from NADH through the peripheral domain to ubiquinone

  • Long-range conformational changes transmitted to the membrane domain

  • Reorganization of charged residues in nuoA and other membrane subunits

  • Formation of transient water chains that facilitate proton movement

What techniques can reveal nuoA interactions with other Complex I subunits?

Elucidating nuoA interactions with other Complex I subunits requires specialized techniques for membrane protein interactions:

  • Chemical cross-linking followed by mass spectrometry (XL-MS): Using specific cross-linkers like DSS or EDC to capture direct protein-protein interactions, followed by digestion and MS identification of cross-linked peptides

  • Cysteine scanning mutagenesis combined with site-directed spin labeling (SDSL): Introducing cysteine residues at specific positions in nuoA, labeling with spin probes, and performing distance measurements using EPR

  • Pull-down assays with tagged versions of nuoA: To identify direct binding partners within the complex

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction interfaces based on changes in hydrogen exchange rates

  • Native mass spectrometry: For characterizing subcomplexes and their composition

  • Förster resonance energy transfer (FRET): Using fluorescently labeled subunits to detect proximity and conformational changes

Studies in related organisms have shown that nuoA likely interacts directly with nuoH, nuoJ, and nuoK in the membrane domain, forming a module involved in proton translocation .

How can site-directed mutagenesis of nuoA inform our understanding of Complex I function?

Site-directed mutagenesis of nuoA provides valuable insights into Complex I function through systematic modification of key residues. The experimental approach should include:

  • Identification of conserved residues through multiple sequence alignment of nuoA across species

  • Selection of charged residues (Asp, Glu, Lys, His) within transmembrane domains as primary targets

  • Generation of conservative and non-conservative substitutions using overlapping PCR or Gibson Assembly

  • Expression of mutant variants in a system that allows assembly of the complete Complex I

  • Functional characterization comparing wildtype and mutant activities:

    • NADH:ubiquinone oxidoreductase activity

    • Proton pumping efficiency

    • Complex assembly and stability

For example, mutations of charged residues in the middle of transmembrane helices often diminish proton pumping without affecting electron transfer, indicating their role in the proton translocation pathway . This approach has successfully identified functional residues in E. coli Complex I and can be applied to N. europaea nuoA to elucidate its specific contributions to energy conservation in ammonia-oxidizing bacteria.

What considerations are important when designing chimeric constructs with nuoA for functional studies?

Designing chimeric constructs with nuoA requires careful planning to maintain functional integrity while introducing investigational modifications. Key considerations include:

  • Domain boundary identification: Using structural predictions and hydropathy plots to precisely define transmembrane segments and loops

  • Sequence conservation analysis: Maintaining highly conserved regions across species while modifying variable regions

  • Fusion junction design: Creating seamless junctions at loop regions rather than within transmembrane helices

  • Compatible expression systems: Ensuring the expression system can accommodate the chimeric construct

  • Verification methods: Including reporter tags at non-interfering positions to confirm expression and localization

Successful chimeric designs might include:

  • Domain swapping between nuoA homologs from different species to identify species-specific functional adaptations

  • Introduction of fluorescent proteins at the C-terminus for localization studies

  • Creation of split-protein complementation systems to study assembly dynamics

How can reconstitution systems be optimized for studying nuoA within the complete Complex I?

Optimizing reconstitution systems for studying nuoA within Complete I requires careful control of multiple parameters to achieve functional membrane protein complexes:

  • Lipid composition: Use a mixture of E. coli polar lipids (70%) and phosphatidylcholine (30%) as a starting point, but optimize the ratio experimentally for N. europaea proteins

  • Protein:lipid ratio: Begin with 1:50 (w/w) and adjust based on activity measurements

  • Reconstitution method selection:

    • Detergent dialysis: Gentler but slower, better for complex assemblies

    • Detergent adsorption using Bio-Beads: Faster but may affect complex integrity

  • Buffer optimization: Include osmolytes like glycerol (5-10%) and physiologically relevant ions

  • Temperature control: Perform reconstitution at 4-10°C to maintain protein stability

  • Verification of orientation: Use limited proteolysis or antibody accessibility to confirm proper orientation

A step-by-step optimization approach involves:

  • Initial screenings using fluorescence-based proton pumping assays

  • Verification of electron transfer with oxygen consumption measurements

  • Assessment of complex integrity through freeze-fracture electron microscopy

  • Functional verification through inhibitor sensitivity tests

The reconstituted system should demonstrate inhibitor sensitivity similar to native membranes, particularly to specific Complex I inhibitors like rotenone or piericidin A .

How does the structural and functional characterization of nuoA in N. europaea inform our understanding of energy conservation in ammonia-oxidizing bacteria?

The characterization of nuoA in Nitrosomonas europaea provides critical insights into energy conservation mechanisms in ammonia-oxidizing bacteria. N. europaea derives all its energy from the oxidation of ammonia to nitrite and must efficiently convert this limited energy source into a proton motive force . The specialized Complex I containing nuoA represents one of the main proton-pumping complexes in this bacterium's respiratory chain.

Analysis reveals several key adaptations:

  • The N. europaea Complex I appears streamlined compared to heterotrophic bacteria, with limited alternative electron input modules

  • The genome sequence shows a relatively limited number of optional paths to terminal electron acceptors, with only one type of terminal oxidase of the aa3 family present

  • NuoA likely evolved specific sequence adaptations to optimize proton pumping efficiency under the energetic constraints of ammonia oxidation

This specialized respiratory chain configuration explains how ammonia-oxidizing bacteria can survive with such a limited energy source. The study of nuoA contributes to our broader understanding of how obligate chemolithoautotrophs adapt their energy conservation mechanisms to thrive in nitrogen-rich environments with little or no organic carbon available .

What approaches can resolve the proton translocation pathway within nuoA at the molecular level?

Resolving the proton translocation pathway within nuoA at the molecular level requires integrating computational and experimental approaches:

  • Molecular dynamics simulations:

    • All-atom simulations of nuoA embedded in a lipid bilayer

    • Analysis of water molecule dynamics within the transmembrane region

    • Identification of transient water chains that could facilitate proton movement

    • Free energy calculations for proton movement along potential pathways

  • Advanced mutagenesis approaches:

    • Histidine scanning mutagenesis to identify positions that can function in proton transfer

    • Double mutant cycle analysis to detect coupled residues in the proton path

    • Incorporation of unnatural amino acids with altered pKa values to probe proton transfer steps

  • Time-resolved spectroscopic methods:

    • Attenuated total reflection Fourier-transform infrared spectroscopy (ATR-FTIR) to track protonation/deprotonation events

    • Ultrafast spectroscopy to follow the kinetics of proton movement

  • Structural biology techniques:

    • High-resolution cryo-electron microscopy of the intact Complex I

    • X-ray crystallography of subcomplexes containing nuoA

    • Neutron diffraction to locate hydrogen atoms/protons directly

How can nuoA be utilized in comparative studies to understand respiratory adaptations across diverse ammonia-oxidizing bacteria?

NuoA provides an excellent target for comparative studies to understand respiratory adaptations across diverse ammonia-oxidizing bacteria (AOB). The approach should involve:

  • Phylogenetic analysis:

    • Construction of nuoA phylogenetic trees across AOB from different environments

    • Correlation of sequence variations with ecological niches (marine vs. terrestrial, pH adaptation)

    • Identification of lineage-specific insertions/deletions or conserved motifs

  • Heterologous expression systems:

    • Expression of nuoA variants from different AOB in a common host

    • Measurement of proton pumping efficiency and electron transfer rates

    • Assessment of stability under various environmental conditions

  • Chimeric protein analysis:

    • Creation of chimeric proteins containing segments from different AOB nuoA proteins

    • Functional characterization to map adaptations to specific protein regions

    • Correlation with environmental parameters of source organisms

  • Structural comparison:

    • Homology modeling of nuoA from diverse AOB based on existing Complex I structures

    • Analysis of surface charge distribution and hydrophobicity profiles

    • Identification of potential adaptation hotspots in transmembrane regions

This comparative approach can reveal how energy conservation mechanisms have evolved in response to different environmental pressures across ammonia-oxidizing bacteria. For example, comparing nuoA from N. europaea (terrestrial) with homologs from the marine γ-proteobacterial ammonia oxidizer Nitrosococcus could illuminate adaptations to marine environments with different pH and salt concentrations .

What strategies can overcome the challenges of studying membrane proteins like nuoA in isolation?

Studying membrane proteins like nuoA in isolation presents significant challenges due to their hydrophobicity, instability outside the membrane environment, and functional dependence on other Complex I subunits. Effective strategies include:

  • Optimized detergent screening:

    • Systematic evaluation of multiple detergent classes (maltoside, glucoside, neopentyl glycol)

    • Detergent mixtures that mimic the lateral pressure of native membranes

    • Use of amphipols or nanodiscs as detergent alternatives

  • Fusion protein approaches:

    • Creation of fusion constructs with highly soluble partners (MBP, SUMO, GFP)

    • Split-intein systems for post-purification removal of solubility tags

    • Careful design of linker regions to prevent interference with function

  • Co-expression strategies:

    • Simultaneous expression of interacting Complex I subunits

    • Use of polycistronic constructs to ensure stoichiometric production

    • Co-expression with specialized chaperones for membrane protein folding

  • Stabilizing mutations:

    • Introduction of disulfide bonds to rigidify flexible regions

    • Surface entropy reduction through mutation of flexible charged residues

    • Thermostabilizing mutations identified through directed evolution

  • Alternative membrane mimetics:

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Peptide-based nanodiscs for controlled membrane environment

    • Lipodisqs for maintaining native lipid interactions

These approaches should be applied systematically, with functional validation at each step to ensure that the isolated nuoA maintains its native conformation and interaction capabilities.

How can researchers distinguish between direct effects of nuoA modifications and indirect effects on Complex I assembly?

Distinguishing between direct functional effects of nuoA modifications and indirect effects on Complex I assembly requires a multi-faceted approach:

  • Assembly analysis techniques:

    • Blue Native PAGE to assess complex formation and stability

    • Size exclusion chromatography to evaluate complex integrity

    • Crosslinking mass spectrometry to map subunit interactions

    • Pulse-chase experiments to track assembly kinetics

  • Controlled expression systems:

    • Inducible promoters with fine-tuned expression levels

    • Temperature-sensitive variants to allow assembly before activating mutations

    • Complementation systems in nuoA knockout backgrounds

  • Comparative functional metrics:

    • Electron transfer activity normalized to assembled complex quantities

    • Proton pumping efficiency per complex

    • Specific inhibitor sensitivity as a measure of proper active site formation

  • Microscopic techniques:

    • Fluorescently tagged subunits to track localization and assembly

    • Single-particle tracking to assess membrane mobility

    • Super-resolution microscopy to visualize complex formation

  • Structural integrity verification:

    • Limited proteolysis patterns compared between wildtype and mutants

    • Accessibility of epitopes using conformation-specific antibodies

    • HDX-MS to detect subtle conformational changes

By implementing these approaches, researchers can create a decision tree to classify observed phenotypes as direct functional effects or assembly-related consequences. This distinction is critical for accurate interpretation of mutagenesis studies targeting nuoA.

What are the current limitations in computational modeling of nuoA, and how might they be addressed?

Current computational modeling of nuoA faces several limitations that affect accuracy and predictive power:

  • Membrane protein force field limitations:

    • Inadequate parameterization for lipid-protein interactions

    • Inaccurate representation of the membrane-water interface

    • Solution: Development of specialized force fields validated against experimental membrane protein data

  • Timescale constraints:

    • Proton translocation occurs on microsecond to millisecond timescales

    • Standard MD simulations typically reach nanoseconds to microseconds

    • Solution: Enhanced sampling techniques (metadynamics, replica exchange) and coarse-grained approaches

  • Proton transfer modeling challenges:

    • Classical MD cannot model bond breaking/formation

    • Quantum effects important for proton tunneling

    • Solution: QM/MM hybrid methods focusing quantum treatment on proton transfer regions

  • Complex assembly modeling:

    • Difficulty in simulating the entire Complex I due to size

    • Interdependence of nuoA function on other subunits

    • Solution: Modular approach with careful boundary conditions and multi-scale modeling

  • Template limitations for homology modeling:

    • Limited high-resolution structures of bacterial Complex I

    • Sequence divergence between model organisms and N. europaea

    • Solution: Integration of experimental constraints (crosslinking, EPR) into model refinement

Future directions to address these limitations include:

  • Development of polarizable force fields specific for membrane proteins

  • Implementation of constant pH molecular dynamics to capture protonation state changes

  • Application of machine learning approaches to extend simulation timescales

  • Integration of experimental data through hybrid modeling approaches

These advances will improve our ability to model nuoA structure and function, ultimately providing better predictions for experimental design and interpretation.

Table 1: Comparison of Key Properties of NADH-quinone oxidoreductase subunit A across Bacterial Species

SpeciesProtein Size (aa)Number of Transmembrane HelicesKey Functional ResiduespI ValueNotable Adaptations
Nitrosomonas europaea121-1263D25, H38, K749.8Adaptation to ammonia-oxidizing lifestyle
Escherichia coli1473D23, H37, K709.2Well-studied model system
Vibrio cholerae (Na+-NQR)N/A (different system)N/AN/AN/AUses Na+ instead of H+ as coupling ion
Thermus thermophilus1193D27, H40, K769.5Thermostability adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.