Recombinant Nitrosomonas europaea NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Respiratory Chain

nuoK is a core subunit of NDH-1, a multi-subunit complex responsible for:

  • Electron transfer: Mediates NADH oxidation and quinone reduction (NADH+Q+5H+NAD++QH2+4H+\text{NADH} + \text{Q} + 5\text{H}^+ \rightarrow \text{NAD}^+ + \text{QH}_2 + 4\text{H}^+) .

  • Proton translocation: Contributes to the proton gradient across the membrane, essential for ATP synthesis .

  • Stress adaptation: Upregulated under oxygen-limited conditions in N. europaea, suggesting a role in maintaining redox balance .

Production and Purification

The recombinant nuoK is produced via heterologous expression in E. coli, followed by affinity chromatography using its His tag . Critical steps include:

  • Reconstitution: Lyophilized protein is solubilized in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

  • Quality control: Purity verified by SDS-PAGE; activity assays measure NADH-dependent quinone reduction kinetics .

Mechanistic Studies

  • Used to dissect electron transport pathways in ammonia-oxidizing bacteria .

  • Serves as a model for probing proton-pumping mechanisms in microbial bioenergetics .

Biotechnological Innovations

  • Engineered variants (e.g., mutation E183A in homologous E. coli NuoF) enable NADPH production optimization .

  • Applied in synthetic biology for designing redox-sensitive biosensors .

Table 2: Functional Comparison of NADH Dehydrogenase Subunits

OrganismSubunitKey FeatureReference
N. europaeanuoKMembrane-anchored; essential for NDH-1 assembly
E. colinuoFCatalytic NADH-binding site; mutations alter substrate specificity
Azotobacter vinelandiiNDH-2AOxygen-tolerant; dominant under high O₂ conditions

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles degrade activity; glycerol stabilization is recommended .

  • Unresolved questions: Role of nuoK in nitric oxide (NO) detoxification pathways remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NE1767; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
nuoK
Target Protein Sequence
MVSLSHYLVLGALLFAIGVVGIFLNRKNVIILLMSIELMLLAVNMNFVAFSHFLQDTAGQ IFVFFILTVAAAEAAIGLAILVALFRNLRTINVDDLDELKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the primary electron acceptor is believed to be ubiquinone. This enzyme couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons. This process conserves the redox energy within a proton gradient.
Database Links

KEGG: neu:NE1767

STRING: 228410.NE1767

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NuoK fit into the respiratory system of Nitrosomonas europaea?

Nitrosomonas europaea possesses three distinct copies of Complex I (NADH-quinone oxidoreductase), with NuoK being a component of the canonical complex . This respiratory enzyme plays a critical role in the bioenergetics of N. europaea, which as an obligate chemolithoautotroph derives all its energy and reductant from the oxidation of ammonia to nitrite .

In the respiratory chain, NuoK participates in:

  • Electron transfer processes from NADH to ubiquinone

  • Proton translocation across the bacterial membrane, contributing to energy conservation

  • Maintenance of redox balance during ammonia oxidation

The genome analysis of N. europaea reveals that Complex I containing NuoK is essential for reverse electron flow, which is crucial for generating reduction equivalents (NADH) required for CO2 fixation during autotrophic growth .

What expression systems are effective for producing recombinant NuoK?

The recombinant expression of NuoK presents specific challenges due to its hydrophobic nature as a membrane protein. The most effective approach involves:

  • Expression Host: E. coli is the preferred heterologous expression system, as demonstrated in successful recombinant production of His-tagged NuoK .

  • Vector Selection: pET-based expression systems containing T7 promoters provide controlled and high-level expression of the target protein.

  • Affinity Tags: N-terminal His-tag facilitates purification via metal chelate chromatography without significantly affecting protein structure .

  • Expression Conditions:

    • Induction with IPTG at lower temperatures (16-25°C)

    • Extended expression periods (overnight)

    • Use of specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Solubilization: Detergents such as DDM (n-dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide) are effective for membrane protein extraction while maintaining native-like conformations.

What are the storage and stability characteristics of recombinant NuoK?

Recombinant NuoK stability is influenced by several factors that researchers should consider:

  • Storage Buffer Composition: Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been shown to maintain protein stability .

  • Storage Temperature: The purified protein should be stored at -20°C/-80°C for long-term preservation .

  • Lyophilization: The protein can be provided as a lyophilized powder to enhance stability during transport and storage .

  • Reconstitution Protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for aliquots intended for long-term storage

  • Freeze-Thaw Stability: Multiple freeze-thaw cycles should be avoided as they can lead to protein denaturation and functional loss .

What analytical methods are used to assess NuoK purity and identity?

Several analytical techniques are employed to verify the purity, identity, and structural integrity of recombinant NuoK:

  • SDS-PAGE Analysis: Provides information on protein purity (>90% purity standard) and apparent molecular weight .

  • Western Blotting: Using anti-His antibodies confirms the identity of the recombinant protein.

  • Mass Spectrometry:

    • MALDI-TOF MS can confirm the intact protein mass

    • LC-MS/MS of tryptic digests provides sequence coverage verification

    • Similar techniques have been successfully used for identification of related NADH-quinone oxidoreductase subunits

  • Circular Dichroism: Evaluates secondary structure elements, particularly important for alpha-helical membrane proteins.

  • Size-Exclusion Chromatography: Assesses protein homogeneity and oligomeric state.

What functional assays can be used to study NuoK activity within the Complex I framework?

Studying the activity of NuoK requires consideration of its role within the larger NADH-quinone oxidoreductase complex. Several functional assays have been developed:

  • NADH Oxidation Assays:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Various electron acceptors can be used:

      • Menadione for NADH dehydrogenase activity

      • Ubiquinone/quinone for complete Complex I activity

  • Quinone Reductase Activity:

    • Measures sodium-stimulated component of oxidation of dNADH (reduced nicotinamide hypoxanthine dinucleotide)

    • Reaction media typically contains 20 mM HEPES-Tris, 5 mM MgSO₄, and 50 mM KCl (pH 8.0)

  • Activity Measurement Parameters:

    • For dNADH:menadione oxidoreductase activity, the reaction medium is supplemented with 50 μM menadione

    • An extinction coefficient (ε₃₄₀) of 6.22 mM⁻¹cm⁻¹ is used for NADH/dNADH quantitation

    • Activities are typically reported as nmol·min⁻¹·mg⁻¹ protein

  • Membrane Potential Measurements:

    • Fluorescent probes (e.g., DiSC3(5), TMRM) can measure proton-pumping activity

    • Proton translocation stoichiometry can be determined using pH indicators

  • Reconstitution Systems:

    • Proteoliposomes containing purified Complex I components

    • Allows assessment of proton translocation coupled to NADH oxidation

How can mutagenesis approaches for NuoK inform our understanding of Complex I assembly and function?

Site-directed mutagenesis of NuoK provides valuable insights into structure-function relationships within Complex I:

  • Key Residue Identification:

    • Conserved residues in transmembrane regions often play critical roles in proton translocation

    • Similar to studies on NqrD/NqrE, mutation of conserved cysteine residues can affect complex assembly

  • Recommended Mutagenesis Strategy:

    • Target conserved residues across bacterial species

    • Create conservative substitutions (e.g., Cys→Ser) that maintain similar structure but alter function

    • Generate alanine-scanning mutants of transmembrane regions

  • Functional Impact Assessment:

    • Effects on complex assembly can be monitored by BN-PAGE or co-immunoprecipitation

    • Activity measurements reveal functional consequences:

    Mutation TypeNADH Dehydrogenase ActivityQuinone Reductase ActivityComplex Assembly
    Conservative (e.g., C→S)Often retainedVariable impactMay be affected
    Charge reversal (e.g., D→K)Often lostStrongly affectedSeverely disrupted
    Hydrophobic (e.g., L→A)Variable impactVariable impactOften maintained
  • Comparative Analysis:

    • Studies on related systems like Na⁺-NQR have shown that mutations in membrane subunits can completely prevent complex maturation

    • For example, mutations in conserved cysteine residues in NqrM (Cys33→Ser) prevented Na⁺-NQR maturation

  • Cross-linking Studies:

    • Cysteine pairs can be introduced to identify subunit interaction interfaces

    • Disulfide cross-linking patterns reveal proximity relationships within the complex

What are the challenges in reconstituting functional respiratory complexes containing NuoK?

Reconstitution of membrane protein complexes like those containing NuoK presents several technical challenges:

  • Protein Extraction Issues:

    • Detergent selection is critical - it must effectively solubilize the complex while maintaining structural integrity

    • Common detergents include DDM, digitonin, and LMNG

    • Lipid-to-protein ratios must be optimized

  • Co-expression Requirements:

    • Complete complex formation often requires co-expression of multiple subunits

    • Expression of V. harveyi Na⁺-NQR subunits in E. coli demonstrated that multiple components (operon plus maturation factors) were required for full activity

    • Similar principles may apply to N. europaea Complex I

  • Activity Reconstitution Data:
    Comparative activity studies from related systems show:

    Expression SystemComponentsActivity (nmol·min⁻¹·mg⁻¹)
    E. coli + operon onlyNqrA-F<1 (Na⁺-stimulated)
    E. coli + operon + maturation factorsNqrA-F, ApbE, NqrM65 ± 8 (Na⁺-stimulated)
  • Cofactor Incorporation:

    • Proper insertion of iron-sulfur clusters is essential

    • May require specific maturation factors for correct assembly

    • Similar to how NqrM is required for iron center formation in Na⁺-NQR

  • Proteoliposome Preparation:

    • Lipid composition affects stability and activity

    • Methods include detergent dialysis, gel filtration, and direct incorporation

    • Activity assessment requires careful control of internal/external buffer conditions

How does NuoK contribute to energy conservation during ammonia oxidation in Nitrosomonas europaea?

The role of NuoK-containing Complex I in the bioenergetics of N. europaea involves several specialized adaptations:

  • Reverse Electron Transport:

    • N. europaea requires NADH for CO₂ fixation during autotrophic growth

    • Complex I operates in reverse to generate NADH from quinol, consuming proton motive force

    • Transcriptomic analysis indicates that specific Complex I copies (complex I_2 containing NuoK) are highly expressed during nitrite-oxidizing conditions

  • Energy Conservation Mechanisms:

    • NuoK-containing complexes participate in proton translocation

    • The canonical complex I containing NuoK likely has a H⁺/e⁻ ratio of 4:1

    • This high ratio is essential for efficient energy coupling during reverse electron transport

  • Integration with Nitrogen Metabolism:

    • During ammonia oxidation, electrons flow from hydroxylamine oxidoreductase to the quinone pool

    • NuoK-containing Complex I then participates in reverse electron flow to generate NADH

    • This NADH is essential for CO₂ fixation via the Calvin-Benson-Bassham cycle

  • Oxygen Limitation Response:

    • Under oxygen-limited conditions, N. europaea significantly alters its respiratory chain gene expression

    • Both heme-copper-containing cytochrome c oxidases are upregulated

    • The relationship between Complex I and terminal oxidases changes to accommodate altered electron flow

  • Nitrogen Oxide Production:

    • N. europaea produces NO and N₂O as byproducts of metabolism

    • Complex I activity indirectly influences this production by affecting cellular redox status

    • Under oxygen limitation, growth yield is reduced and ammonia-to-nitrite conversion becomes non-stoichiometric

What are the current methodological approaches for studying protein-protein interactions within Complex I involving NuoK?

Advanced techniques for investigating protein-protein interactions within multi-subunit membrane complexes like NADH-quinone oxidoreductase include:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinkers (e.g., DSS, BS3) can capture transient interactions

    • Zero-length crosslinkers (e.g., EDC) identify direct contacts

    • Analysis by LC-MS/MS reveals interaction interfaces

    • Similar approaches have identified subunit arrangements in Na⁺-NQR

  • Cryo-Electron Microscopy:

    • Enables visualization of intact membrane complexes at near-atomic resolution

    • Sample preparation typically involves:

      • Purification in amphipols or nanodiscs

      • Vitrification on holey carbon grids

      • Collection of thousands of particle images

    • 3D reconstruction reveals subunit positioning and transmembrane arrangements

  • Co-Immunoprecipitation Studies:

    • Antibodies against tagged subunits can pull down interaction partners

    • Western blotting identifies co-precipitated components

    • Quantitative MS can determine stoichiometry of interactions

  • Two-Hybrid Membrane Protein Systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) or split-ubiquitin systems

    • Specifically designed for membrane protein interactions

    • Allow systematic screening of binary interactions

  • Native Mass Spectrometry:

    • Emerging technique for intact membrane protein complexes

    • Detergent removal in the gas phase preserves non-covalent interactions

    • Provides information on subunit stoichiometry and stability

    • Has successfully characterized other respiratory complexes

  • Fluorescence-Based Approaches:

    • FRET (Förster Resonance Energy Transfer) between labeled subunits

    • BRET (Bioluminescence Resonance Energy Transfer) for in vivo studies

    • Fluorescence Correlation Spectroscopy (FCS) for dynamic interactions

These methodologies, when applied systematically, can elucidate the precise role of NuoK within the complex architecture of NADH-quinone oxidoreductase in Nitrosomonas europaea.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.