Recombinant Nitrosomonas europaea Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag type, please specify this in your order; we will prioritize its development.
Synonyms
crcB; NE1704; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
crcB
Target Protein Sequence
MWKPILAIALGSTLGGLLRWGLGLKLNNLFPDVPPGTLVANLIAGYVVGVAIAFFAHMPN LSPEWRLLVITGFCGGLSTFSTFSAEIVSLLQRGLYAWAMSAIAVHVAGSLIMTLAGIAT VTWFKSS
Uniprot No.

Target Background

Function

Important for reducing intracellular fluoride concentration and mitigating its toxicity.

Database Links

KEGG: neu:NE1704

STRING: 228410.NE1704

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog in Nitrosomonas europaea and what is its predicted function?

The CrcB homolog in Nitrosomonas europaea is a membrane protein believed to function as a fluoride ion channel or transporter. The protein is part of a highly conserved family found across bacteria, archaea, and eukaryotes that primarily functions in fluoride ion efflux, providing resistance to fluoride toxicity. In bacterial systems like N. europaea, CrcB forms a dual-topology dimeric ion channel that allows fluoride ions to exit the cell, preventing inhibition of key metabolic enzymes.

While not directly mentioned in the available transcriptomic studies, CrcB likely plays a role in maintaining ion homeostasis during environmental stress responses in N. europaea, similar to its function in other bacterial species . The gene may be part of the stress response network activated when N. europaea faces toxic compounds or environmental limitations.

How is the crcB gene organized in the N. europaea genome and what regulatory elements control its expression?

The crcB gene in N. europaea is encoded within the chromosome as part of the complete genome sequence. While specific regulatory elements for crcB were not directly identified in the available studies, N. europaea contains multiple stress-responsive transcription factors and σ-factors that may regulate crcB expression.

The genome of N. europaea contains 29 genes annotated as σ-70 factors, including 23 extracytoplasmic function (ECF) σ-factors . When exposed to stressors like chloroform, N. europaea upregulates 9 of these σ-factors, which could potentially regulate stress-responsive genes like crcB. Computational analysis of the N. europaea genome has identified potential regulons controlled by these σ-factors by analyzing nucleotide weight profiles and candidate site scores .

How does the CrcB homolog in N. europaea compare to CrcB proteins in other bacteria?

The CrcB homolog in N. europaea shares structural and functional similarities with other bacterial CrcB proteins, though with specific adaptations related to the unique metabolism of this ammonia-oxidizing bacterium.

OrganismCrcB Similarity to N. europaeaKey DifferencesFunctional Implications
E. coli~40-60% sequence identity (estimated)Different genetic neighborhoodDifferential regulation under stress
Other ammonia-oxidizing bacteriaHigher conservation (~70-85% identity estimated)Species-specific adaptationsSimilar role in ion homeostasis
Nitrosococcus speciesModerate similarityDifferent membrane integrationAdaptation to marine environments

While not specifically detailed in the provided search results, CrcB proteins typically contain 4-5 transmembrane helices and function as fluoride channels or transporters across various bacterial species. The primary structure typically consists of approximately 120-130 amino acids forming a dual-topology assembly in the membrane.

What expression systems are most effective for producing recombinant N. europaea CrcB protein?

For recombinant expression of N. europaea CrcB protein, researchers should consider several expression systems depending on the specific research goals:

  • E. coli-based expression systems:

    • BL21(DE3) with pET vector systems yields moderate protein quantities

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression may provide better yields with reduced toxicity

    • The use of fusion tags (MBP, SUMO, or His-tag) significantly improves solubility and purification efficiency

  • Cell-free expression systems:

    • Effective for potentially toxic membrane proteins like CrcB

    • Allows direct incorporation into nanodiscs or liposomes for functional studies

    • Provides opportunity for site-specific incorporation of unnatural amino acids for biophysical studies

When designing expression constructs, researchers should note that N. europaea can have different codon usage patterns compared to E. coli, potentially requiring codon optimization. Additionally, the choice of affinity tag and its position (N- or C-terminal) may affect proper membrane insertion and folding of the CrcB protein.

What are the critical considerations for successful purification of recombinant CrcB from N. europaea?

Purification of membrane proteins like CrcB requires specialized approaches:

  • Membrane extraction optimization:

    • Detergent screening is critical (typical starting points include DDM, LMNG, or C12E8)

    • Detergent concentration must be optimized to achieve efficient extraction without denaturation

    • Solubilization time and temperature significantly impact yield and activity

  • Chromatographic purification strategy:

    • Initial capture: IMAC (immobilized metal affinity chromatography) with His-tagged CrcB

    • Secondary purification: Size exclusion chromatography to separate monomeric vs. oligomeric states

    • Consider ion exchange chromatography as a polishing step

  • Critical buffer components:

    • Maintain detergent above CMC throughout purification

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

    • Optimize pH based on theoretical isoelectric point of N. europaea CrcB

Purification StepBuffer CompositionCritical ParametersExpected Yield
Membrane isolation50 mM Tris pH 8.0, 150 mM NaClLow-speed vs. high-speed centrifugation3-5 mg membrane protein/L culture
Solubilization50 mM Tris pH 8.0, 150 mM NaCl, 1% DDM1-2 hours, 4°C, gentle agitation60-80% extraction efficiency
IMAC50 mM Tris pH 8.0, 300 mM NaCl, 0.05% DDMImidazole gradient: 20-300 mM0.5-1 mg CrcB/L culture
Size exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDMFlow rate: 0.5 ml/min70-90% recovery from IMAC

Success in purification should be evaluated by SDS-PAGE, western blotting, and functional assays to ensure the recombinant protein maintains its native structure and activity.

How can researchers investigate changes in CrcB expression under different environmental conditions?

Similar to the transcriptomic studies conducted for N. europaea under different growth conditions, researchers can analyze crcB expression through several complementary approaches:

  • Transcriptomic analysis:

    • RNA-seq to quantify transcript levels under various conditions

    • qRT-PCR for targeted analysis of crcB expression

    • Microarray analysis similar to that used for studying chloroform and chloromethane exposure

For example, the transcriptomic response of N. europaea under oxygen limitation versus ammonia limitation revealed significant differences in gene expression patterns . Similar approaches could be applied to study crcB expression:

  • Growth condition variations to test:

    • Oxygen limitation vs. ammonia limitation (as in previous studies )

    • Exposure to toxic compounds (chloroform, chloromethane )

    • Presence of varying fluoride concentrations

    • pH variations that might affect ion transport needs

  • Protein level analysis:

    • Western blotting with antibodies against CrcB or epitope tags

    • Proteomics approaches (similar to those used in previous N. europaea studies )

    • GFP-fusion reporter systems for real-time visualization

Previous studies on N. europaea showed that upon exposure to chloroform, 175 of 2,460 genes showed higher transcript levels while 501 showed lower levels . Researchers could examine if crcB is among the differentially regulated genes under such stressful conditions, giving insight into its role in stress response.

What experimental approaches can determine the functional role of CrcB in fluoride resistance in N. europaea?

To establish the role of CrcB in fluoride resistance, researchers should implement a multi-faceted approach:

  • Gene deletion and complementation studies:

    • Generate crcB knockout strains using established genetic tools for N. europaea

    • Complement with wild-type and mutated versions of crcB

    • Assess growth kinetics in the presence of varying fluoride concentrations

  • Fluoride sensitivity assays:

    • Minimum inhibitory concentration (MIC) determination for fluoride

    • Growth curve analysis in varying fluoride concentrations

    • Viability assays (Live/Dead staining) after fluoride exposure

  • Direct measurement of fluoride transport:

    • Fluoride-selective electrode measurements with whole cells

    • Reconstitution of purified CrcB in liposomes for fluoride efflux assays

    • Fluorescent probe-based assays for real-time monitoring

  • Impact on ammonia oxidation:

    • Measure ammonia-dependent O₂ uptake activity in the presence of fluoride

    • Assess nitrite production rates with and without fluoride exposure

    • Compare effects between wild-type and crcB mutant strains

Previous studies on N. europaea have successfully measured ammonia-dependent O₂ uptake activity and nitrite production rates under various stress conditions , and similar methodologies could be adapted for studying fluoride effects and CrcB's protective role.

What methods are most appropriate for structural characterization of the N. europaea CrcB protein?

Structural characterization of membrane proteins like CrcB requires specialized approaches:

  • X-ray crystallography:

    • Similar to approaches used for nitrosocyanin from N. europaea (resolved to 1.65 Å)

    • Requires optimization of crystallization conditions with appropriate detergents

    • May benefit from lipidic cubic phase methods specific for membrane proteins

  • Cryo-electron microscopy:

    • Increasingly powerful for membrane protein structure determination

    • Can resolve oligomeric arrangements of CrcB in the membrane

    • May reveal conformational states relevant to transport mechanism

  • NMR spectroscopy:

    • Solid-state NMR for full-length protein in membrane mimetics

    • Solution NMR for soluble domains or fragments

    • Can provide dynamics information not accessible by other methods

  • Computational structure prediction:

    • Homology modeling based on available CrcB structures

    • Ab initio modeling using advanced tools like AlphaFold

    • Molecular dynamics simulations to understand conformational flexibility

The nitrosocyanin protein from N. europaea was successfully crystallized and its structure determined at 1.65 Å resolution for the oxidized form and 2.3 Å for the reduced form . This demonstrates that proteins from this organism can be successfully subjected to structural analysis. The study revealed that nitrosocyanin forms a trimer of single domain cupredoxins with unique coordination geometry , highlighting how structural studies can reveal unexpected arrangements and functional insights.

How do mutations in conserved residues affect CrcB structure and function?

The relationship between structure and function in CrcB can be investigated through systematic mutagenesis:

  • Identification of conserved residues:

    • Bioinformatic analysis of CrcB homologs across species

    • Categorization of residues by conservation, location, and predicted function

    • Focus on putative channel-lining residues and selectivity determinants

  • Site-directed mutagenesis strategy:

    • Conservative vs. non-conservative substitutions

    • Charge reversals at key positions

    • Cysteine scanning mutagenesis for accessibility studies

  • Functional impact assessment:

    • Fluoride transport assays with purified mutant proteins

    • Growth complementation studies in crcB-deficient strains

    • Thermostability analysis to detect structural perturbations

  • Structural validation:

    • Limited proteolysis to probe conformational changes

    • Circular dichroism spectroscopy for secondary structure analysis

    • Distance measurements using EPR spectroscopy or FRET

Residue TypeMutation StrategyExpected Functional ImpactStructural Analysis Method
Channel-liningHydrophobic to chargedAltered ion selectivityElectrophysiology
Gating residuesAlanine substitutionChanged transport kineticsSingle-molecule FRET
Dimerization interfaceDisruptive mutationsImpaired oligomerizationSize exclusion chromatography
Conserved across all CrcBSaturation mutagenesisFunctional classificationDeep mutational scanning

Similar mutagenesis approaches combined with structural studies have provided insights into the function of other N. europaea proteins, as seen in the comparison between nitrosocyanin's red copper center versus blue copper centers in other proteins .

How does CrcB expression in N. europaea correlate with stress response pathways under different environmental conditions?

Understanding the integration of CrcB within broader stress response networks requires examination of gene expression patterns across conditions:

  • Comparative transcriptomics:

    • Similar to studies of N. europaea response to chloroform and chloromethane

    • Analysis of co-expressed gene clusters under fluoride stress

    • Temporal transcription patterns during acute vs. chronic stress

In chloroform-treated N. europaea, transcripts for 175 genes were found at higher levels and 501 at lower levels compared to untreated cells . These included genes for heat shock proteins, σ-factors of the extracytoplasmic function subfamily, and toxin-antitoxin loci. Researchers should investigate whether crcB forms part of this stress response network.

  • Regulatory network analysis:

    • ChIP-seq to identify transcription factors binding to crcB promoter

    • Analysis of potential σ-factor binding sites near crcB

    • Examination of post-transcriptional regulation (small RNAs, riboswitches)

N. europaea upregulated 9 of its 29 genes annotated as σ-70 factors when exposed to chloroform, with 8 belonging to the extracytoplasmic function subfamily . These factors could potentially regulate crcB expression under stress conditions.

  • Fluoride-specific vs. general stress responses:

    • Compare crcB expression with known stress markers (heat shock proteins, oxidative stress genes)

    • Evaluate cross-protection between fluoride resistance and other stressors

    • Assess fitness trade-offs of crcB expression under various conditions

Stress ConditionExpected CrcB ResponseCo-regulated PathwaysExperimental Validation
Fluoride exposureStrong upregulationMembrane integrity genesqRT-PCR, reporter assays
Oxygen limitationPotential regulationEnergy conservation genesComparison to O₂-limited transcriptome
Chlorinated compoundsModerate upregulationGeneral stress response genesCorrelation with chloroform response
pH stressContext-dependentIon homeostasis genesGrowth at varying pH with/without fluoride

What role might CrcB play in the adaptation of N. europaea to environmental stressors in wastewater treatment settings?

N. europaea is crucial in wastewater treatment processes, and understanding CrcB's role in environmental adaptation has practical implications:

  • Survival under fluctuating conditions:

    • CrcB may contribute to resilience against industrial fluoride contamination

    • Protection of key metabolic enzymes from fluoride inhibition

    • Maintenance of ammonia oxidation activity under suboptimal conditions

  • Biofilm formation and community interactions:

    • Potential role in biofilm persistence during toxic exposure

    • Contribution to competitive fitness in mixed microbial communities

    • Impact on quorum sensing or intercellular signaling during stress

  • Experimental approaches for wastewater settings:

    • Laboratory-scale bioreactors with defined fluoride challenges

    • Transcriptomic analysis of N. europaea in actual wastewater samples

    • Competition experiments between wild-type and crcB mutants

  • Biotechnological applications:

    • Engineering enhanced fluoride resistance for improved bioremediation

    • Development of N. europaea-based biosensors for fluoride detection

    • Utilization of CrcB expression as a biomarker for specific environmental stressors

Previous studies have shown that N. europaea can adapt to limited oxygen conditions by altering the expression of genes involved in CO₂ fixation and upregulating distinct heme-copper-containing cytochrome c oxidases . Similarly, CrcB may participate in adaptive responses to specific stressors in wastewater treatment environments.

How can recombinant CrcB be utilized as a research tool for studying ion transport mechanisms?

Recombinant CrcB protein can serve as a valuable research tool:

  • Reconstitution systems for transport studies:

    • Proteoliposomes loaded with fluoride-sensitive probes

    • Planar lipid bilayer electrophysiology for single-channel recordings

    • Nanodiscs for structural and functional studies in a native-like environment

  • Biosensor development:

    • CrcB-based fluoride sensors for environmental monitoring

    • FRET-based sensors for real-time fluoride transport visualization

    • Cell-based reporters for high-throughput screening applications

  • Comparative analysis across species:

    • Functional comparison of CrcB homologs from diverse bacteria

    • Chimeric proteins to identify domain-specific functions

    • Evolution of fluoride resistance mechanisms across microbial lineages

  • Drug discovery applications:

    • CrcB as a target for antimicrobial development

    • Screening for specific inhibitors of bacterial fluoride channels

    • Structure-based design of channel blockers

The detailed structural characterization achieved for other N. europaea proteins, such as nitrosocyanin , demonstrates the feasibility of obtaining high-resolution structural data that can inform functional studies of CrcB and its applications as a research tool.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.