Undecaprenyl-diphosphatase (EC 3.6.1.27) from Nitrosomonas europaea is a membrane-integrated enzyme that serves a critical function in bacterial cell wall biosynthesis. The enzyme is encoded by the uppP gene (with synonyms bacA and upk) in the N. europaea genome, specifically as ordered locus name NE0039 . The recombinant form of this protein is produced for research and analytical purposes, maintaining the functional and structural integrity of the native enzyme. In the UniProt database, this protein is cataloged under accession number Q82Y49, providing a standardized reference point for researchers studying this enzyme .
The enzyme belongs to a family of phosphatases that specifically target undecaprenyl pyrophosphate (C55-PP) as their substrate, converting it to undecaprenyl phosphate (C55-P). This reaction is central to the recycling of lipid carriers in bacterial cell wall synthesis. Interruption of this regeneration process typically leads to the accumulation of cell wall intermediates and ultimately results in bacterial cell lysis, highlighting the enzyme's essential nature for bacterial survival .
The enzyme is formally known as Undecaprenyl-diphosphatase with the EC number 3.6.1.27, indicating its classification as a hydrolase acting on acid anhydrides. Alternative names for this enzyme include "Bacitracin resistance protein" and "Undecaprenyl pyrophosphate phosphatase" . These alternative designations reflect different aspects of the protein's function - the former highlighting its role in conferring resistance to the antibiotic bacitracin, and the latter emphasizing its specific enzymatic activity.
While the search results don't provide specific phylogenetic information about N. europaea uppP, the conservation of this enzyme across bacterial species suggests its fundamental importance in bacterial physiology. The presence of homologous enzymes in diverse bacterial species, including the well-studied E. coli version, indicates an evolutionary conservation of this essential cellular mechanism .
The recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase consists of 273 amino acids in its full-length form. The complete amino acid sequence is:
MDWLILLKALLLGIVEGLTEFLPISSTGHLILAGDLLNFNDDKAKVFTVAIQLGAILAVC
WEYRERLVNIIRNLGTRQANRFVINLFIAFLPAAILGLLFIKTIKHYLFHPMPVAIALVT
GGILILWAERREHRIEAETVDDMSWKQALQVGCAQCLALIPGTSRSGATIIGGLLFGLSR
KAAAEFSFFLAIPVMFAATFYDVYKHREFLYIDDLGMFATGSVAAFISALIAIRGFIRYI
SHHDFTLFAWYRIGFGLIVLLTAYSGLVDWSVD
The expression region for this protein encompasses residues 1-273, representing the complete protein sequence . The amino acid composition shows a prevalence of hydrophobic residues, consistent with its nature as an integral membrane protein.
Undecaprenyl-diphosphatase catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to produce undecaprenyl phosphate (C55-P). This hydrolysis reaction can be represented as:
Undecaprenyl pyrophosphate + H₂O → Undecaprenyl phosphate + Phosphate
The enzyme functions by cleaving the terminal phosphate group from the pyrophosphate moiety of the substrate. While the specific catalytic mechanism of the N. europaea enzyme has not been directly detailed in the search results, it likely shares similarities with other bacterial phosphatases, particularly those from the same family.
The function of UppP is integral to the recycling of lipid carriers in bacterial cell wall synthesis. In bacteria, cell wall components are initially assembled in the cytoplasm on undecaprenyl phosphate (C55-P) before being flipped to the periplasmic face of the membrane. After the building blocks are transferred to the growing cell wall, undecaprenyl pyrophosphate (C55-PP) remains as a side product .
UppP's role is to convert this C55-PP back to C55-P, thereby regenerating the lipid carrier for continued cell wall synthesis. This recycling function is essential for the ongoing biosynthesis of peptidoglycan and other cell wall polymers. Disruption of this process leads to an accumulation of cell wall intermediates and eventual cell lysis, making UppP a potential target for antimicrobial development .
The alternative designation of UppP as a "Bacitracin resistance protein" highlights its role in antimicrobial resistance mechanisms. Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thus inhibiting cell wall synthesis. Elevated expression or activity of UppP can counteract this effect by increasing the rate of conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, thereby reducing the target availability for bacitracin .
The recombinant Nitrosomonas europaea UppP is produced using standard recombinant protein expression systems, though the specific expression host is not detailed in the search results. The protein is derived from Nitrosomonas europaea strain ATCC 19718 / NBRC 14298, which serves as the genetic source for the uppP gene .
The expression construct typically includes the complete coding sequence (residues 1-273) of the N. europaea uppP gene, potentially with additional sequences encoding affinity tags to facilitate purification. The specific tag type is determined during the production process and may vary depending on the manufacturer's protocols .
While specific purification protocols are not detailed in the search results, recombinant membrane proteins like UppP typically require specialized extraction and purification methods. These may include detergent-based extraction from expression host membranes, followed by affinity chromatography leveraging the attached purification tags.
Quality control measures would likely include verification of protein identity through mass spectrometry, purity assessment via SDS-PAGE, and potentially functional assays to confirm enzymatic activity.
Given the essential role of UppP in bacterial cell wall synthesis, it represents a potential target for novel antimicrobial development. Inhibitors of this enzyme could disrupt bacterial cell wall synthesis, leading to cell lysis. The availability of recombinant UppP enables high-throughput screening of potential inhibitors and structure-based drug design approaches.
The connection between UppP and bacitracin resistance also highlights its relevance to understanding antimicrobial resistance mechanisms. Studies using the recombinant protein could provide insights into how bacteria develop resistance to cell wall-targeting antibiotics .
The availability of recombinant N. europaea UppP allows for comparative studies with homologous enzymes from other bacterial species. Such comparisons can reveal evolutionary relationships, species-specific adaptations, and conserved functional mechanisms. The crystal structure of E. coli UppP, for instance, provides a valuable reference point for structural comparisons with the N. europaea enzyme .
The commercially available recombinant protein is suitable for various analytical applications, including:
Enzyme-linked immunosorbent assays (ELISA)
Western blotting
Enzyme activity assays
Protein-protein interaction studies
Structural biology investigations
The ELISA-grade recombinant protein is specifically formulated for immunological detection methods, ensuring consistent and reliable results in antibody-based detection systems .
KEGG: neu:NE0039
STRING: 228410.NE0039
Nitrosomonas europaea Undecaprenyl-diphosphatase (uppP) is an enzyme (EC 3.6.1.27) also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase. It plays a crucial role in cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate. The protein consists of 273 amino acids and has been fully sequenced, with its amino acid sequence available in databases with UniProt ID Q82Y49 .
Functionally, uppP contributes to the membrane recycling processes essential for bacterial cell wall synthesis. In Nitrosomonas europaea, which is a gram-negative obligate chemolithoautotroph that derives all its energy from the oxidation of ammonia to nitrite, this enzyme is part of the complex metabolic network that supports the organism's unique energy production system .
When working with recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase, researchers must comply with the NIH Guidelines for Recombinant DNA Research, regardless of funding source. All non-exempt research with this recombinant protein must be registered with the Institutional Biosafety Committee (IBC) before initiating any experiments. This requirement applies even when obtaining the recombinant protein from commercial sources or other scientists .
The registration process typically involves completing a Recombinant DNA Registration form and submitting it to the institutional Biosafety Office. Depending on the nature of the research and the biocontainment level required, additional documentation may be necessary. Researchers should use institutional tools, such as rDNA Survey Tools, to determine whether their work with uppP is exempt or non-exempt .
Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase should be stored at -20°C for regular storage, and at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .
For handling, it is recommended to:
Avoid repeated freezing and thawing cycles, as this can degrade protein structure and activity
Prepare working aliquots that can be stored at 4°C for up to one week
Thaw frozen samples on ice and maintain cold chain management during experiments
Use sterile technique when handling to prevent contamination
These storage and handling protocols help maintain the structural integrity and enzymatic activity of the recombinant protein for experimental applications .
When designing experiments to study the enzymatic activity of Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase, researchers should follow a structured approach:
Define your variables:
Independent variable: Typically enzyme concentration, substrate concentration, pH, temperature, or presence of inhibitors
Dependent variable: Rate of dephosphorylation, typically measured by phosphate release or substrate depletion
Control variables: Buffer composition, ionic strength, presence of cofactors
Formulate a specific, testable hypothesis about the enzyme's activity, for example, how substrate concentration affects reaction rate or how potential inhibitors impact enzyme function
Design experimental treatments:
Measurement methodology:
For uppP activity, colorimetric assays detecting released phosphate are commonly used
HPLC methods can quantify the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate
Consider using radiolabeled substrates for increased sensitivity
Temperature control is particularly important as Nitrosomonas europaea is environmentally sensitive, given its role in the biogeochemical nitrogen cycle .
To generate a recombinant expression system for Nitrosomonas europaea Undecaprenyl-diphosphatase with fluorescent protein reporters, you can adapt the methodology used for other Nitrosomonas europaea proteins:
Identify and amplify the uppP gene (gene ID: NE0039) from Nitrosomonas europaea genome (ATCC 19718)
Select an appropriate promoter:
Create transcriptional fusions:
Transform N. europaea:
Use established transformation protocols for N. europaea
Select transformants using appropriate antibiotics
Verify expression:
Measure fluorescence to confirm successful expression
Validate protein production through Western blot or activity assays
This approach has been successfully used to create recombinant N. europaea expressing GFP under different conditions, with up to 18-fold increases in fluorescence observed under specific treatment conditions .
Nitrosomonas europaea Undecaprenyl-diphosphatase belongs to a family of membrane-embedded phosphatases that play critical roles in bacterial cell wall synthesis. The comparison with similar enzymes reveals important insights:
Understanding these similarities and differences is crucial for researchers developing targeted inhibitors or studying the evolution of cell wall biosynthesis pathways across bacterial species. The unique ecological niche of N. europaea as an ammonia-oxidizing bacterium may have influenced the evolution of its uppP enzyme to function optimally in its specific metabolic context .
When faced with data that contradicts your hypothesis about Nitrosomonas europaea Undecaprenyl-diphosphatase function, follow this methodological approach:
Thoroughly examine the data to identify specific discrepancies:
Evaluate initial assumptions and research design:
Consider alternative explanations:
Modify data collection if necessary:
Refine variables and implement additional controls:
Remember that unexpected results often lead to the most significant scientific discoveries. For example, despite having a functional nitric oxide reductase gene cluster, N. europaea studies revealed unexpected patterns of nitrous oxide production, demonstrating the presence of alternative metabolic pathways .
To comprehensively study the role of Undecaprenyl-diphosphatase in Nitrosomonas europaea metabolism, researchers should integrate genomic and proteomic approaches:
Genomic analysis:
Utilize the complete genome sequence of N. europaea (2,812,094 bp circular chromosome) to identify genetic contexts of the uppP gene (NE0039)
Perform comparative genomics to identify conserved regions in uppP across ammonia-oxidizing bacteria
Analyze the GC skew and transcriptional orientation, considering that approximately 47% of genes are transcribed from one strand and 53% from the complementary strand in N. europaea
Transcriptomic studies:
Employ RNA-Seq to examine uppP expression under different growth conditions
Identify co-expressed genes that might function in related pathways
Study transcriptional regulators that control uppP expression
Proteomic approaches:
Use mass spectrometry to identify post-translational modifications on uppP
Employ protein-protein interaction studies to identify binding partners
Conduct metabolic labeling to trace the role of uppP in cell wall precursor recycling
Integration strategies:
Develop computational models that integrate genomic, transcriptomic, and proteomic data
Create gene knockout or knockdown strains to observe metabolic effects
Use systems biology approaches to place uppP in the context of N. europaea's unique energy metabolism that derives all its energy from ammonia oxidation
This integrated approach will provide a comprehensive understanding of how uppP functions within the broader context of N. europaea's specialized metabolism as an obligate chemolithoautotroph .
When engineering recombinant Nitrosomonas europaea strains expressing modified Undecaprenyl-diphosphatase, several biosafety considerations must be addressed:
Regulatory compliance:
Risk assessment:
Evaluate whether modifications to uppP might alter antibiotic resistance profiles, as uppP (also known as Bacitracin resistance protein) contributes to antibiotic resistance
Assess potential ecological impacts if the engineered strain were accidentally released, considering N. europaea's role in nitrogen cycling
Determine appropriate biocontainment level based on the risk assessment
Laboratory procedures:
Implement proper containment measures as determined by the risk assessment
Use biological safety cabinets for manipulations that might generate aerosols
Establish protocols for decontamination and waste disposal
Genetic stability considerations:
Emergency response:
These considerations help ensure that research with recombinant N. europaea strains is conducted safely and responsibly, minimizing risks to researchers, the public, and the environment.
CRISPR-Cas9 technology offers powerful approaches to study Undecaprenyl-diphosphatase function in Nitrosomonas europaea:
Gene knockout strategies:
Gene editing for functional studies:
Introduce point mutations in catalytic residues to study structure-function relationships
Create domain swaps with uppP genes from other bacteria to identify species-specific functional elements
Generate tagged versions of uppP for localization studies
Regulatory element analysis:
Adaptation considerations for N. europaea:
Optimize transformation protocols for delivery of CRISPR components
Select appropriate promoters for Cas9 expression in N. europaea
Consider using a two-plasmid system: one for Cas9 and one for sgRNA
Validation approaches:
Confirm edits through sequencing
Verify phenotypic changes through enzymatic assays
Use complementation studies to confirm genotype-phenotype relationships
These approaches can be particularly valuable for understanding the essential nature of uppP in N. europaea and its contribution to the organism's unique physiology as an ammonia-oxidizing bacterium that derives all its energy from the oxidation of ammonia to nitrite .