Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Undecaprenyl-diphosphatase from Nitrosomonas europaea

Undecaprenyl-diphosphatase (EC 3.6.1.27) from Nitrosomonas europaea is a membrane-integrated enzyme that serves a critical function in bacterial cell wall biosynthesis. The enzyme is encoded by the uppP gene (with synonyms bacA and upk) in the N. europaea genome, specifically as ordered locus name NE0039 . The recombinant form of this protein is produced for research and analytical purposes, maintaining the functional and structural integrity of the native enzyme. In the UniProt database, this protein is cataloged under accession number Q82Y49, providing a standardized reference point for researchers studying this enzyme .

The enzyme belongs to a family of phosphatases that specifically target undecaprenyl pyrophosphate (C55-PP) as their substrate, converting it to undecaprenyl phosphate (C55-P). This reaction is central to the recycling of lipid carriers in bacterial cell wall synthesis. Interruption of this regeneration process typically leads to the accumulation of cell wall intermediates and ultimately results in bacterial cell lysis, highlighting the enzyme's essential nature for bacterial survival .

Nomenclature and Alternative Designations

The enzyme is formally known as Undecaprenyl-diphosphatase with the EC number 3.6.1.27, indicating its classification as a hydrolase acting on acid anhydrides. Alternative names for this enzyme include "Bacitracin resistance protein" and "Undecaprenyl pyrophosphate phosphatase" . These alternative designations reflect different aspects of the protein's function - the former highlighting its role in conferring resistance to the antibiotic bacitracin, and the latter emphasizing its specific enzymatic activity.

Evolutionary Context

While the search results don't provide specific phylogenetic information about N. europaea uppP, the conservation of this enzyme across bacterial species suggests its fundamental importance in bacterial physiology. The presence of homologous enzymes in diverse bacterial species, including the well-studied E. coli version, indicates an evolutionary conservation of this essential cellular mechanism .

Amino Acid Sequence and Domain Organization

The recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase consists of 273 amino acids in its full-length form. The complete amino acid sequence is:

MDWLILLKALLLGIVEGLTEFLPISSTGHLILAGDLLNFNDDKAKVFTVAIQLGAILAVC
WEYRERLVNIIRNLGTRQANRFVINLFIAFLPAAILGLLFIKTIKHYLFHPMPVAIALVT
GGILILWAERREHRIEAETVDDMSWKQALQVGCAQCLALIPGTSRSGATIIGGLLFGLSR
KAAAEFSFFLAIPVMFAATFYDVYKHREFLYIDDLGMFATGSVAAFISALIAIRGFIRYI
SHHDFTLFAWYRIGFGLIVLLTAYSGLVDWSVD

The expression region for this protein encompasses residues 1-273, representing the complete protein sequence . The amino acid composition shows a prevalence of hydrophobic residues, consistent with its nature as an integral membrane protein.

Catalytic Activity and Reaction Mechanism

Undecaprenyl-diphosphatase catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to produce undecaprenyl phosphate (C55-P). This hydrolysis reaction can be represented as:

Undecaprenyl pyrophosphate + H₂O → Undecaprenyl phosphate + Phosphate

The enzyme functions by cleaving the terminal phosphate group from the pyrophosphate moiety of the substrate. While the specific catalytic mechanism of the N. europaea enzyme has not been directly detailed in the search results, it likely shares similarities with other bacterial phosphatases, particularly those from the same family.

Role in Bacterial Cell Wall Biosynthesis

The function of UppP is integral to the recycling of lipid carriers in bacterial cell wall synthesis. In bacteria, cell wall components are initially assembled in the cytoplasm on undecaprenyl phosphate (C55-P) before being flipped to the periplasmic face of the membrane. After the building blocks are transferred to the growing cell wall, undecaprenyl pyrophosphate (C55-PP) remains as a side product .

UppP's role is to convert this C55-PP back to C55-P, thereby regenerating the lipid carrier for continued cell wall synthesis. This recycling function is essential for the ongoing biosynthesis of peptidoglycan and other cell wall polymers. Disruption of this process leads to an accumulation of cell wall intermediates and eventual cell lysis, making UppP a potential target for antimicrobial development .

Connection to Bacitracin Resistance

The alternative designation of UppP as a "Bacitracin resistance protein" highlights its role in antimicrobial resistance mechanisms. Bacitracin is an antibiotic that binds to undecaprenyl pyrophosphate, preventing its dephosphorylation and thus inhibiting cell wall synthesis. Elevated expression or activity of UppP can counteract this effect by increasing the rate of conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, thereby reducing the target availability for bacitracin .

Recombinant Protein Expression Systems

The recombinant Nitrosomonas europaea UppP is produced using standard recombinant protein expression systems, though the specific expression host is not detailed in the search results. The protein is derived from Nitrosomonas europaea strain ATCC 19718 / NBRC 14298, which serves as the genetic source for the uppP gene .

The expression construct typically includes the complete coding sequence (residues 1-273) of the N. europaea uppP gene, potentially with additional sequences encoding affinity tags to facilitate purification. The specific tag type is determined during the production process and may vary depending on the manufacturer's protocols .

Purification and Quality Control

While specific purification protocols are not detailed in the search results, recombinant membrane proteins like UppP typically require specialized extraction and purification methods. These may include detergent-based extraction from expression host membranes, followed by affinity chromatography leveraging the attached purification tags.

Quality control measures would likely include verification of protein identity through mass spectrometry, purity assessment via SDS-PAGE, and potentially functional assays to confirm enzymatic activity.

Antimicrobial Drug Development

Given the essential role of UppP in bacterial cell wall synthesis, it represents a potential target for novel antimicrobial development. Inhibitors of this enzyme could disrupt bacterial cell wall synthesis, leading to cell lysis. The availability of recombinant UppP enables high-throughput screening of potential inhibitors and structure-based drug design approaches.

The connection between UppP and bacitracin resistance also highlights its relevance to understanding antimicrobial resistance mechanisms. Studies using the recombinant protein could provide insights into how bacteria develop resistance to cell wall-targeting antibiotics .

Comparative Studies with Other Bacterial Species

The availability of recombinant N. europaea UppP allows for comparative studies with homologous enzymes from other bacterial species. Such comparisons can reveal evolutionary relationships, species-specific adaptations, and conserved functional mechanisms. The crystal structure of E. coli UppP, for instance, provides a valuable reference point for structural comparisons with the N. europaea enzyme .

Analytical Applications

The commercially available recombinant protein is suitable for various analytical applications, including:

  • Enzyme-linked immunosorbent assays (ELISA)

  • Western blotting

  • Enzyme activity assays

  • Protein-protein interaction studies

  • Structural biology investigations

The ELISA-grade recombinant protein is specifically formulated for immunological detection methods, ensuring consistent and reliable results in antibody-based detection systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; NE0039; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Target Names
uppP
Target Protein Sequence
MDWLILLKALLLGIVEGLTEFLPISSTGHLILAGDLLNFNDDKAKVFTVAIQLGAILAVC WEYRERLVNIIRNLGTRQANRFVINLFIAFLPAAILGLLFIKTIKHYLFHPMPVAIALVT GGILILWAERREHRIEAETVDDMSWKQALQVGCAQCLALIPGTSRSGATIIGGLLFGLSR KAAAEFSFFLAIPVMFAATFYDVYKHREFLYIDDLGMFATGSVAAFISALIAIRGFIRYI SHHDFTLFAWYRIGFGLIVLLTAYSGLVDWSVD
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: neu:NE0039

STRING: 228410.NE0039

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrosomonas europaea Undecaprenyl-diphosphatase (uppP) and what are its primary functions?

Nitrosomonas europaea Undecaprenyl-diphosphatase (uppP) is an enzyme (EC 3.6.1.27) also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase. It plays a crucial role in cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate. The protein consists of 273 amino acids and has been fully sequenced, with its amino acid sequence available in databases with UniProt ID Q82Y49 .

Functionally, uppP contributes to the membrane recycling processes essential for bacterial cell wall synthesis. In Nitrosomonas europaea, which is a gram-negative obligate chemolithoautotroph that derives all its energy from the oxidation of ammonia to nitrite, this enzyme is part of the complex metabolic network that supports the organism's unique energy production system .

What regulatory requirements must be followed when working with recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase?

When working with recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase, researchers must comply with the NIH Guidelines for Recombinant DNA Research, regardless of funding source. All non-exempt research with this recombinant protein must be registered with the Institutional Biosafety Committee (IBC) before initiating any experiments. This requirement applies even when obtaining the recombinant protein from commercial sources or other scientists .

The registration process typically involves completing a Recombinant DNA Registration form and submitting it to the institutional Biosafety Office. Depending on the nature of the research and the biocontainment level required, additional documentation may be necessary. Researchers should use institutional tools, such as rDNA Survey Tools, to determine whether their work with uppP is exempt or non-exempt .

How should Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase be stored and handled for optimal stability?

Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase should be stored at -20°C for regular storage, and at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

For handling, it is recommended to:

  • Avoid repeated freezing and thawing cycles, as this can degrade protein structure and activity

  • Prepare working aliquots that can be stored at 4°C for up to one week

  • Thaw frozen samples on ice and maintain cold chain management during experiments

  • Use sterile technique when handling to prevent contamination

These storage and handling protocols help maintain the structural integrity and enzymatic activity of the recombinant protein for experimental applications .

What are the optimal experimental design considerations when studying the enzymatic activity of Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase?

When designing experiments to study the enzymatic activity of Recombinant Nitrosomonas europaea Undecaprenyl-diphosphatase, researchers should follow a structured approach:

  • Define your variables:

    • Independent variable: Typically enzyme concentration, substrate concentration, pH, temperature, or presence of inhibitors

    • Dependent variable: Rate of dephosphorylation, typically measured by phosphate release or substrate depletion

    • Control variables: Buffer composition, ionic strength, presence of cofactors

  • Formulate a specific, testable hypothesis about the enzyme's activity, for example, how substrate concentration affects reaction rate or how potential inhibitors impact enzyme function

  • Design experimental treatments:

    • Include appropriate negative controls (no enzyme) and positive controls (known active enzyme)

    • Create concentration gradients for kinetic studies

    • Consider time-course experiments to establish linear ranges of activity

  • Measurement methodology:

    • For uppP activity, colorimetric assays detecting released phosphate are commonly used

    • HPLC methods can quantify the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate

    • Consider using radiolabeled substrates for increased sensitivity

Temperature control is particularly important as Nitrosomonas europaea is environmentally sensitive, given its role in the biogeochemical nitrogen cycle .

How can I generate a recombinant expression system for Nitrosomonas europaea Undecaprenyl-diphosphatase with fluorescent protein reporters?

To generate a recombinant expression system for Nitrosomonas europaea Undecaprenyl-diphosphatase with fluorescent protein reporters, you can adapt the methodology used for other Nitrosomonas europaea proteins:

  • Identify and amplify the uppP gene (gene ID: NE0039) from Nitrosomonas europaea genome (ATCC 19718)

  • Select an appropriate promoter:

    • Consider using promoters that have been successful in N. europaea, such as the promoter regions of mbla (NE2571) or clpB (NE2402)

    • These promoters have been shown to drive expression of green fluorescent protein (GFP) in N. europaea

  • Create transcriptional fusions:

    • Clone the promoter and the uppP gene into a suitable vector (such as pPRO vectors previously used for N. europaea)

    • Add a GFP or other fluorescent protein gene downstream of the uppP gene, either as a fusion protein or as a separate transcriptional unit

  • Transform N. europaea:

    • Use established transformation protocols for N. europaea

    • Select transformants using appropriate antibiotics

  • Verify expression:

    • Measure fluorescence to confirm successful expression

    • Validate protein production through Western blot or activity assays

This approach has been successfully used to create recombinant N. europaea expressing GFP under different conditions, with up to 18-fold increases in fluorescence observed under specific treatment conditions .

How does the structure and function of Nitrosomonas europaea Undecaprenyl-diphosphatase compare to similar enzymes in other bacterial species?

Nitrosomonas europaea Undecaprenyl-diphosphatase belongs to a family of membrane-embedded phosphatases that play critical roles in bacterial cell wall synthesis. The comparison with similar enzymes reveals important insights:

FeatureN. europaea uppPCommon bacterial uppPImplications for research
Amino acid sequence273 amino acids with specific membrane-spanning domains Typically 250-300 amino acids with conserved catalytic residuesDifferences in sequence may explain species-specific antibiotic susceptibility
Membrane topologyMultiple transmembrane segments forming a hydrophobic core 8-10 transmembrane segments is typicalTarget for structure-based drug design
Catalytic mechanismDephosphorylation of undecaprenyl pyrophosphateConserved across speciesPotential for broad-spectrum inhibitor development
Genetic contextLocated in the N. europaea genome as gene NE0039 Often part of operons involved in cell wall synthesisDifferent regulatory mechanisms may exist

Understanding these similarities and differences is crucial for researchers developing targeted inhibitors or studying the evolution of cell wall biosynthesis pathways across bacterial species. The unique ecological niche of N. europaea as an ammonia-oxidizing bacterium may have influenced the evolution of its uppP enzyme to function optimally in its specific metabolic context .

What strategies should be employed when unexpected data contradicts hypotheses about Nitrosomonas europaea Undecaprenyl-diphosphatase function?

When faced with data that contradicts your hypothesis about Nitrosomonas europaea Undecaprenyl-diphosphatase function, follow this methodological approach:

  • Thoroughly examine the data to identify specific discrepancies:

    • Look for outliers that may have influenced results

    • Compare findings with existing literature on uppP function

    • Analyze patterns in the contradictory data that might reveal new insights

  • Evaluate initial assumptions and research design:

    • Review experimental controls and validate reagents

    • Consider whether the assay conditions were appropriate for a membrane-bound enzyme like uppP

    • Assess whether the recombinant form may behave differently than the native enzyme

  • Consider alternative explanations:

    • The enzyme may have secondary functions not previously characterized

    • Post-translational modifications might affect activity

    • The unique metabolic context of N. europaea might influence enzyme behavior

  • Modify data collection if necessary:

    • Employ alternative assay methods to validate findings

    • Consider in vivo studies in addition to in vitro experiments

    • Use site-directed mutagenesis to probe functional domains

  • Refine variables and implement additional controls:

    • Test activity under different physiological conditions relevant to N. europaea's ammonia-oxidizing lifestyle

    • Include related enzymes from other bacteria as comparative controls

Remember that unexpected results often lead to the most significant scientific discoveries. For example, despite having a functional nitric oxide reductase gene cluster, N. europaea studies revealed unexpected patterns of nitrous oxide production, demonstrating the presence of alternative metabolic pathways .

How can genomic and proteomic approaches be integrated to study the role of Undecaprenyl-diphosphatase in Nitrosomonas europaea metabolism?

To comprehensively study the role of Undecaprenyl-diphosphatase in Nitrosomonas europaea metabolism, researchers should integrate genomic and proteomic approaches:

  • Genomic analysis:

    • Utilize the complete genome sequence of N. europaea (2,812,094 bp circular chromosome) to identify genetic contexts of the uppP gene (NE0039)

    • Perform comparative genomics to identify conserved regions in uppP across ammonia-oxidizing bacteria

    • Analyze the GC skew and transcriptional orientation, considering that approximately 47% of genes are transcribed from one strand and 53% from the complementary strand in N. europaea

  • Transcriptomic studies:

    • Employ RNA-Seq to examine uppP expression under different growth conditions

    • Identify co-expressed genes that might function in related pathways

    • Study transcriptional regulators that control uppP expression

  • Proteomic approaches:

    • Use mass spectrometry to identify post-translational modifications on uppP

    • Employ protein-protein interaction studies to identify binding partners

    • Conduct metabolic labeling to trace the role of uppP in cell wall precursor recycling

  • Integration strategies:

    • Develop computational models that integrate genomic, transcriptomic, and proteomic data

    • Create gene knockout or knockdown strains to observe metabolic effects

    • Use systems biology approaches to place uppP in the context of N. europaea's unique energy metabolism that derives all its energy from ammonia oxidation

This integrated approach will provide a comprehensive understanding of how uppP functions within the broader context of N. europaea's specialized metabolism as an obligate chemolithoautotroph .

What biosafety considerations are necessary when engineering recombinant Nitrosomonas europaea strains expressing modified Undecaprenyl-diphosphatase?

When engineering recombinant Nitrosomonas europaea strains expressing modified Undecaprenyl-diphosphatase, several biosafety considerations must be addressed:

  • Regulatory compliance:

    • Register all non-exempt recombinant DNA work with the Institutional Biosafety Committee (IBC)

    • Complete the required Recombinant DNA Registration form before initiating experiments

    • Ensure compliance with NIH Guidelines for Recombinant DNA Research regardless of funding source

  • Risk assessment:

    • Evaluate whether modifications to uppP might alter antibiotic resistance profiles, as uppP (also known as Bacitracin resistance protein) contributes to antibiotic resistance

    • Assess potential ecological impacts if the engineered strain were accidentally released, considering N. europaea's role in nitrogen cycling

    • Determine appropriate biocontainment level based on the risk assessment

  • Laboratory procedures:

    • Implement proper containment measures as determined by the risk assessment

    • Use biological safety cabinets for manipulations that might generate aerosols

    • Establish protocols for decontamination and waste disposal

  • Genetic stability considerations:

    • Monitor for insertional sequence elements, as N. europaea contains 85 predicted insertion sequence elements in eight different families

    • Design constructs to minimize potential recombination events

    • Test genetic stability over multiple generations

  • Emergency response:

    • Develop an incident response plan for accidental exposures or releases

    • Provide appropriate training to all personnel

    • Maintain detailed documentation of all safety procedures

These considerations help ensure that research with recombinant N. europaea strains is conducted safely and responsibly, minimizing risks to researchers, the public, and the environment.

How can CRISPR-Cas9 technology be applied to study Undecaprenyl-diphosphatase function in Nitrosomonas europaea?

CRISPR-Cas9 technology offers powerful approaches to study Undecaprenyl-diphosphatase function in Nitrosomonas europaea:

  • Gene knockout strategies:

    • Design sgRNAs targeting the uppP gene (NE0039) based on the complete genome sequence of N. europaea

    • Assess the phenotypic effects of uppP deletion on cell wall integrity, growth rate, and antibiotic susceptibility

    • Create a complementation system to verify phenotype attribution to uppP deletion

  • Gene editing for functional studies:

    • Introduce point mutations in catalytic residues to study structure-function relationships

    • Create domain swaps with uppP genes from other bacteria to identify species-specific functional elements

    • Generate tagged versions of uppP for localization studies

  • Regulatory element analysis:

    • Use CRISPR interference (CRISPRi) to modulate uppP expression without complete deletion

    • Target potential regulatory regions to identify control mechanisms

    • Create reporter fusions to study promoter activity under different conditions, similar to approaches used with other N. europaea genes

  • Adaptation considerations for N. europaea:

    • Optimize transformation protocols for delivery of CRISPR components

    • Select appropriate promoters for Cas9 expression in N. europaea

    • Consider using a two-plasmid system: one for Cas9 and one for sgRNA

  • Validation approaches:

    • Confirm edits through sequencing

    • Verify phenotypic changes through enzymatic assays

    • Use complementation studies to confirm genotype-phenotype relationships

These approaches can be particularly valuable for understanding the essential nature of uppP in N. europaea and its contribution to the organism's unique physiology as an ammonia-oxidizing bacterium that derives all its energy from the oxidation of ammonia to nitrite .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.