Recombinant Nitrosomonas eutropha Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Membrane Topology and Catalytic Motifs

The N. eutropha plsY shares conserved structural features with homologs like Streptococcus pneumoniae PlsY, characterized by five transmembrane segments and three cytoplasmic domains . Key functional motifs include:

  • Motif 1: Contains essential serine (Ser) and arginine (Arg) residues critical for catalytic activity.

  • Motif 2: A phosphate-binding loop with conserved glycines required for G3P binding. Mutations here increase the enzyme’s K<sub>m</sub> for G3P .

  • Motif 3: Includes histidine (His), asparagine (Asn), and glutamate (Glu) residues that stabilize the protein’s structure and activity .

DomainFunctionCritical Residues
Motif 1Catalytic activitySer, Arg
Motif 2G3P bindingGlycines
Motif 3Structural integrityHis, Asn, Glu

Substrate Specificity

plsY exclusively utilizes acyl-phosphate as an acyl donor, distinguishing it from other acyltransferases (e.g., PlsC, which uses acyl-ACP or acyl-CoA) . Noncompetitive inhibition by palmitoyl-CoA highlights its substrate selectivity .

Production Systems

Recombinant N. eutropha plsY is typically expressed in E. coli, with tags (e.g., His-tag) for purification . Key features include:

  • Protein Length: Full-length (1–195 amino acids in Rhizobium loti, a close relative) .

  • Tagging: N-terminal His-tag for affinity chromatography .

  • Purity: >90% as determined by SDS-PAGE .

ParameterValueSource
Expression HostE. coli
TagN-terminal His-tag
Storage BufferTris/PBS-based with 6% trehalose

Purification Challenges

As an integral membrane protein, plsY requires detergents like 6-cyclohexyl-1-hexyl-β-d-maltoside to maintain solubility and activity during purification .

Mutational Studies

Site-directed mutagenesis of conserved residues has elucidated functional roles:

  • Motif 2 Glycines → Alanines: Reduces G3P binding affinity, increasing K<sub>m</sub> .

  • Motif 3 Glutamate → Alanines: Disrupts structural stability, abolishing activity .

Biotechnological Relevance

  • Lipid Synthesis: Overexpression of plsY activates the mTOR pathway, suggesting applications in lipid metabolism studies .

  • Protein Studies: Recombinant plsY is used in ELISA kits for antibody development and structural analysis .

Comparative Genomics and Evolution

  • N. eutropha’s genome contains unique adaptations, including heavy metal resistance genes and diverse terminal oxidases, which may influence plsY’s stability in harsh environments .

  • Genomic Context: plsY (locus Neut_0295) is part of a conserved cluster in ammonia-oxidizing bacteria (AOB), though synteny breaks occur between N. eutropha and N. europaea .

Table 1: Amino Acid Sequence Features

FeatureSequenceSource
Full-Length SequenceMITVILIFSAYLLGSISFAVVASWLFKLPDPRSYGSGNPGATNVLRTGKKVAAAVTLLGD...
Conserved MotifsSer (Motif 1), Gly (Motif 2), His/Asn/Glu (Motif 3)

Table 2: Enzymatic Properties

PropertyValueSource
SubstrateAcyl-phosphate → G3P
InhibitorPalmitoyl-CoA (noncompetitive)
K<sub>m</sub> (G3P)Affected by Motif 2 mutations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
plsY; Neut_0295; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Nitrosomonas eutropha (strain C91)
Target Names
plsY
Target Protein Sequence
MITVILIFSAYLLGSISFAVVASWLFKLPDPRSYGSGNPGATNVLRTGKKVAAAVTLLGD AGKGWVAVVVAKYLGNVLGLGDEVIASAALAVFLGHLFPIFLAFKGGKGVATSAGILLGL NLWLGILAILTWIIVALVSRISSLSALLSALLAPLYTYFLLQKEMLTITVLIISILLILK HQSNIANLIAGKETRIGKSS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do the three conserved motifs in plsY contribute to its catalytic function?

The three conserved cytoplasmic domains of plsY each contain distinct motifs that are critical for catalysis:

MotifKey ResiduesFunctionExperimental Evidence
Motif 1Serine, ArginineEssential for acyl transferMutation leads to complete loss of activity
Motif 2Conserved glycinesGlycerol 3-phosphate binding siteMutations result in defective Km for G3P binding
Motif 3Histidine, Asparagine, GlutamateActivity and structural integrityHistidine and asparagine mutations impair activity; glutamate crucial for structure

Site-directed mutagenesis studies have confirmed the functional importance of each conserved domain. Alterations to the conserved glycines in motif 2 specifically result in a defect in the Km for glycerol 3-phosphate binding, indicating this region forms the glycerol 3-phosphate binding pocket .

What are the enzymatic characteristics of bacterial plsY?

Bacterial plsY catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, representing a critical step in the initiation of phosphatidic acid formation during bacterial membrane phospholipid biosynthesis. The enzyme works in concert with PlsX, which converts acyl-acyl carrier protein to acylphosphate. Kinetic studies have shown that plsY is noncompetitively inhibited by palmitoyl-CoA, suggesting complex regulatory mechanisms controlling its activity in vivo . The enzyme's catalytic efficiency and substrate specificity vary across bacterial species, making comparative studies valuable for understanding phospholipid biosynthesis evolution.

What are the recommended protocols for cloning the plsY gene from Nitrosomonas eutropha?

For successful cloning of the plsY gene from Nitrosomonas eutropha, researchers should consider the following methodological approach:

  • Genomic DNA Extraction: Use specialized protocols for gram-negative bacteria, considering that Nitrosomonas eutropha is a gram-negative, ammonia-oxidizing bacterium .

  • PCR Amplification:

    • Design primers based on conserved regions identified through alignment with related species

    • Use high-fidelity DNA polymerase with proofreading capability

    • Optimize PCR conditions: initial denaturation (95°C, 5 min); 30-35 cycles of denaturation (95°C, 30 sec), annealing (55-60°C, 30 sec), extension (72°C, 1-2 min); final extension (72°C, 10 min)

  • Cloning Strategy:

    • Select an expression vector with appropriate promoter (T7 for strong expression)

    • Include affinity tags (His6 or GST) for purification

    • Consider codon optimization for E. coli expression if necessary

    • Include TEV protease cleavage site for tag removal

  • Verification Methods:

    • Restriction enzyme digestion

    • Sanger sequencing to confirm gene sequence integrity

    • Western blot analysis with anti-His or anti-GST antibodies

This protocol mirrors successful approaches used for Nitrosomonas genome sequencing, where random 2-3 kb DNA fragments were isolated after mechanical shearing, end-repaired, and cloned into appropriate vectors .

How can the substituted cysteine accessibility method be optimized for studying membrane proteins like plsY?

The substituted cysteine accessibility method (SCAM) can be optimized for plsY topology studies through the following methodological refinements:

  • Strategic Cysteine Substitution:

    • Generate cysteine-less plsY variant as template

    • Introduce single cysteines at predicted transmembrane boundaries

    • Space mutations approximately every 3-5 amino acids in regions of interest

  • Expression System Optimization:

    • Use mild induction conditions to prevent misfolding/aggregation

    • Consider membrane-mimetic environments during purification

  • Accessibility Analysis:

    • Sequential labeling with membrane-permeable and impermeable thiol-reactive reagents

    • Use small molecule probes like NEM followed by fluorescent maleimides

    • Analyze using SDS-PAGE with fluorescence scanning or MS-based approaches

  • Activity Verification:

    • Confirm each mutant retains activity to ensure native-like folding

    • Measure enzymatic function using acyltransferase activity assays

This methodology has proven successful for determining topology of bacterial membrane proteins like plsY in Streptococcus pneumoniae and could be adapted for Nitrosomonas eutropha studies .

What purification strategies yield the highest activity for recombinant plsY?

Optimized purification strategies for recombinant plsY should account for its integral membrane nature:

  • Membrane Preparation:

    • Cell disruption by sonication or French press

    • Differential centrifugation (10,000×g followed by 100,000×g)

    • Membrane fraction collection and washing

  • Solubilization:

    • Screen detergents: n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), or digitonin

    • Typical working concentration: 1-2% detergent with 1:10 ratio for later dilution

    • Include protease inhibitors and reducing agents

  • Chromatography Sequence:

    Purification StepBuffer CompositionElution Condition
    IMAC (for His-tagged protein)20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% DDM250-300 mM imidazole gradient
    Size exclusion20 mM HEPES pH 7.5, 150 mM NaCl, 0.05% DDMIsocratic elution
    Ion exchange (optional)20 mM MES pH 6.5, 50 mM NaCl, 0.05% DDMNaCl gradient (50-500 mM)
  • Activity Preservation:

    • Add glycerol (10-20%) to storage buffer

    • Store at -80°C in small aliquots

    • Avoid repeated freeze-thaw cycles

Enzyme activity should be assessed at each purification step to track recovery and specific activity enhancement.

How can site-directed mutagenesis be used to elucidate the structure-function relationship of plsY conserved domains?

Site-directed mutagenesis represents a powerful approach for dissecting plsY structure-function relationships:

  • Targeted Mutation Strategy:
    Based on findings from S. pneumoniae plsY, researchers should target:

    • Serine and arginine residues in Motif 1

    • Conserved glycines in the phosphate-binding loop of Motif 2

    • Histidine, asparagine, and glutamate residues in Motif 3

  • Mutation Types to Consider:

    Mutation TypePurposeExpected Outcome
    Alanine scanningNeutralize side chain functionIdentify essential residues
    Conservative substitutionsPreserve charge/sizeExamine chemical requirements
    Non-conservative changesAlter properties dramaticallyTest tolerance to major changes
    Cysteine substitutionsEnable chemical modificationProbe accessibility and function
  • Functional Assessment Protocols:

    • Enzymatic activity assays comparing wild-type vs. mutant proteins

    • Substrate binding studies using isothermal titration calorimetry

    • Thermal stability measurements to assess structural integrity

    • Membrane integration analysis using fluorescence techniques

  • Data Interpretation Framework:

    • Residues causing complete activity loss: likely directly involved in catalysis

    • Residues affecting Km: implicated in substrate binding

    • Residues affecting stability but not Km or kcat: structural role

This approach successfully identified the glycerol 3-phosphate binding site in Motif 2 of PlsY in previous studies and can be applied to Nitrosomonas eutropha plsY.

What are the implications of plsY inhibition in bacterial phospholipid biosynthesis?

The inhibition of plsY has profound implications for bacterial membrane formation and cellular viability:

  • Metabolic Consequences:
    plsY catalyzes an essential step in phosphatidic acid formation, which serves as a precursor for all glycerophospholipids. Inhibition results in disruption of membrane phospholipid composition, potentially affecting:

    • Membrane fluidity and permeability

    • Protein-lipid interactions crucial for membrane protein function

    • Cell division processes dependent on membrane synthesis

  • Regulatory Networks:
    plsY inhibition may trigger compensatory mechanisms including:

    • Upregulation of alternative lipid biosynthesis pathways

    • Altered expression of membrane proteins

    • Stress response activation

  • Species-Specific Considerations for Nitrosomonas eutropha:
    As an ammonia-oxidizing bacterium with specialized membrane requirements, N. eutropha may exhibit unique responses to plsY inhibition. Its metabolic specialization for ammonia oxidation suggests potential interconnections between energy metabolism and membrane biosynthesis that warrant investigation.

  • Research Applications:
    Understanding plsY inhibition mechanisms provides insights for:

    • Developing targeted antimicrobial strategies

    • Engineering bacteria with modified membrane compositions

    • Studying bacterial adaptation to membrane stress

How conserved is plsY across different bacterial species including Nitrosomonas eutropha?

The conservation pattern of plsY across bacterial species reveals evolutionary insights into phospholipid biosynthesis:

  • Sequence Conservation Analysis:
    Genomic studies of related species like Nitrosomonas europaea demonstrate high conservation of essential metabolic genes, with notable adaptation to their ecological niches. N. europaea possesses genes dedicated to ammonia catabolism, energy generation, and biosynthetic pathways . Similarly, plsY conservation follows functional constraints:

    DomainConservation LevelEvolutionary Implication
    Catalytic motifs (1-3)Highly conservedEssential for enzymatic function
    Membrane-spanning regionsModerately conservedAdaptation to species-specific membrane environments
    Cytoplasmic loopsVariablePotential species-specific regulatory interactions
  • Phylogenetic Distribution:
    plsY represents the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation in bacterial membrane phospholipid biosynthesis . This conservation underscores its fundamental role in bacterial cell biology, though species-specific variations exist that likely reflect adaptation to different ecological niches.

  • Nitrosomonas-Specific Features:
    Based on genomic knowledge of Nitrosomonas species, which show specialized adaptations for ammonia metabolism , their plsY may contain unique features that facilitate function within their specialized membrane environment while maintaining the core catalytic machinery.

What is known about the evolution of bacterial phospholipid biosynthesis pathways based on plsY studies?

Evolutionary analysis of plsY provides insights into the development of phospholipid biosynthesis:

  • Ancestral Reconstruction:
    The widespread distribution of plsY across bacterial phyla suggests it represents an ancient and fundamental pathway for membrane phospholipid synthesis. The two-enzyme system (PlsX and PlsY) that converts acyl-acyl carrier protein to acylphosphate and then transfers the acyl group to glycerol 3-phosphate represents a conserved metabolic module .

  • Functional Constraints and Adaptation:
    The three conserved motifs in plsY demonstrate differential evolutionary pressure:

    • Catalytic residues (e.g., serine and arginine in Motif 1) show near-absolute conservation

    • The phosphate-binding loop structure in Motif 2 maintains conserved glycines

    • Structural elements show greater variation, reflecting adaptation to species-specific requirements

  • Genomic Context:
    In Nitrosomonas species, genome studies reveal genes are distributed evenly around the genome, with approximately 47% transcribed from one strand and 53% from the complementary strand . This genomic organization may influence the evolution and expression patterns of phospholipid biosynthesis genes.

  • Metabolic Integration:
    The evolution of plsY appears closely tied to central carbon metabolism and bacterial energy production systems. In specialized bacteria like Nitrosomonas eutropha, which derives energy from ammonia oxidation , membrane phospholipid biosynthesis likely co-evolved with their unique energy metabolism.

What are promising areas for future research on Nitrosomonas eutropha plsY?

Several research directions offer potential for significant advances:

  • Structural Biology Approaches:

    • Cryo-EM studies to determine the complete 3D structure of Nitrosomonas eutropha plsY

    • X-ray crystallography of recombinant plsY to identify species-specific features

    • NMR studies of specific domains to understand dynamic aspects of enzyme function

  • Systems Biology Integration:

    • Metabolic flux analysis connecting ammonia oxidation to membrane lipid synthesis

    • Transcriptomic and proteomic profiling under different growth conditions

    • Computational modeling of phospholipid pathway regulation

  • Biotechnological Applications:

    • Engineering plsY variants with altered substrate specificity

    • Developing biosensors based on plsY activity

    • Exploring antimicrobial targets based on structural differences between bacterial plsY enzymes

  • Environmental Adaptation Studies:

    • Investigating plsY adaptations in Nitrosomonas eutropha strains from different environments

    • Comparing phospholipid profiles and plsY properties across ecological gradients

    • Understanding membrane adaptations to environmental stressors

These research directions would build upon current knowledge of bacterial plsY function and Nitrosomonas eutropha biology to advance both fundamental understanding and applied possibilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.