Recombinant Nitrosomonas eutropha Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage condition, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Neut_2154; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Nitrosomonas eutropha (strain C91)
Target Names
yidC
Target Protein Sequence
MDNKKIVLLIIFSTSLLFLWDAWVKEQEKFNAPPSVVAQANSAAGVTQSKNNDGLPIPGS ELTASQTGSDLNGIPSSGDTADSVTPRLLPSGEQIRVVTDKVIAEIDTMGGDLRRLELLQ QPSPEDENVPYSLLHSEASRTYVAQSGLVGEGLPNHKTVYQVESGIRNYELTAGEDKVVI RLLAPETQGVQVIKTYTFHRDSYVIDIGFEIANKSDATIRPFAYFQMLRDDTPPPAHTMM IRSFLGAAVYTDEEKYQKIPFDDLDKGKTDYPANANNGWIAMLEHYFLTAWLPPQQTPRE YFAKRQSDNLYTAGVIVPAGVITAGETVTTTMPLYAGPEEQDRLAELAPGLELTVDYGWL TMIAKPLFRLLSFYHSWTGNWGIAIILLTITVKLLFFPLSAAGYRSMAKLRLVTPKLKRI QDQYKGDRQRMHQAMMDFYKTEKINPMGGCFPILVQIPVFIALYWTILAAVELRYAPFAL WITDLSSPDPKYLLPVLLGISMFIQTRLNPTPTDPIQAKIMQIMPVAFSAIFFFFPAGLV LYSLVNNILSIAQQWKITKMYGTAPSQDAPESPASKDAPELPVSNQVINDSENTEAPASG PADSPKKPVNIPRRMHKRTRKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of bacterial YidC and how does it facilitate membrane protein insertion?

YidC features a distinctive arrangement of five conserved transmembrane domains with a helical hairpin between transmembrane segment 2 (TM2) and TM3 located on the cytoplasmic membrane surface . This structure creates a specific protein-lipid interface that serves as the insertion site for membrane proteins. Structurally, YidC threads back-and-forth through the membrane five times, with portions extending into the bacterial cell interior .

Functionally, YidC mediates membrane protein insertion through a co-translational mechanism where it interacts with the ribosome at the ribosomal tunnel exit . This positioning allows YidC to receive newly synthesized membrane proteins directly from the ribosome and facilitate their transition from the hydrophilic ribosome-exit tunnel into the hydrophobic membrane environment. YidC can function either independently as a membrane protein insertase or in collaboration with the SecY complex .

How has cryo-electron microscopy enhanced our understanding of YidC function?

Cryo-electron microscopy has provided breakthrough insights into YidC's mechanism by:

This structural information has been crucial for understanding the co-translational mode of YidC-mediated membrane protein insertion . The visualization of YidC bound to a ribosome building a new protein has revealed the amino acids in YidC that interact with both the ribosome and the nascent membrane protein .

What distinguishes YidC in Nitrosomonas eutropha from its homologs in other bacterial species?

While Nitrosomonas eutropha is described as "a motile, gram-negative, bacillus that metabolizes ammonia as its energy source" , specific differences in its YidC protein compared to other bacterial species require further investigation. As an ammonia-oxidizing bacterium with specialized metabolic requirements, Nitrosomonas eutropha likely has membrane adaptations that could influence YidC function, including:

  • Potentially specialized membrane lipid composition to accommodate ammonia oxidation machinery

  • Unique membrane protein substrates related to ammonia metabolism

  • Possible adaptations to function in environments with fluctuating ammonia concentrations and pH levels

  • Potentially distinct YidC regulatory mechanisms specific to its ecological niche

How can researchers effectively express and purify functional recombinant YidC for in vitro studies?

For expressing and purifying recombinant YidC, researchers can employ the following optimized protocol:

  • Clone the YidC gene into an expression vector (such as pBAD22) with an appropriate affinity tag (typically His-tag)

  • Transform the construct into an E. coli expression strain

  • Grow cells to mid-log phase (OD600 ~0.4) before inducing expression with an appropriate inducer (e.g., 0.2% arabinose)

  • Harvest cells after 2 hours of induction and disrupt them using microfluidization (12,000 psi, three passes)

  • Remove unlysed cells by centrifugation (3,000 x g, 10 minutes)

  • Isolate the crude membrane fraction through ultracentrifugation (100,000 x g, 45 minutes)

  • Separate inner and outer membranes using a step-sucrose gradient (20-50-70%)

  • Collect the inner membrane fraction from the 20-50% sucrose interface

  • Solubilize membrane proteins with detergent (typically DDM)

  • Purify using affinity chromatography based on the attached tag

This protocol can be adapted for expressing YidC from Nitrosomonas eutropha with appropriate codon optimization if necessary.

What techniques are most effective for identifying and validating YidC-interacting proteins?

Multiple complementary approaches have proven effective for identifying and validating YidC interactions:

TechniqueApplicationKey Insights
BioID proximity labelingIdentification of proteins in close proximity to YidC in vivoDiscovered YibN as major YidC interactor with highest spectral counts across four replicates
Affinity pulldown with SILAC labelingValidation of interactions under near-native conditionsDemonstrated >20-fold enrichment of YibN with His-tagged YidC and >50-fold enrichment of YidC with His-tagged YibN
Blue-native PAGEVisualization of intact protein complexesRevealed distinct YidC-YibN complex formation dependent on YibN's transmembrane segment
Chemical crosslinkingCapture of transient interactionsIdentified proteins like FtsH, HflK, and HflC as being vicinal to YidC
Reciprocal tagging approachesValidation under native expression conditionsConfirmed YidC-YibN interaction using chromosomally SPA-tagged YibN

Using multiple orthogonal techniques strengthens confidence in identified interactions and helps distinguish functional partners from non-specific associations.

How can researchers assess the functional significance of YidC interactions with partner proteins?

To determine whether YidC interactions are functionally significant, researchers can employ these experimental approaches:

  • Co-expression studies: Express YidC substrates with or without potential interaction partners (e.g., YibN) and monitor substrate biogenesis over time. For example, research showed that co-expression of YibN significantly increased the synthesis of YidC substrates like PC-Lep, Pf3-23Lep, and F0c .

  • In vitro translation/insertion assays: Prepare inverted membrane vesicles (INVs) enriched for YidC or its interaction partners and measure their ability to support substrate insertion. YibN-enriched INVs demonstrated 1.5-1.8-fold stimulation of insertion for multiple YidC substrates .

  • Deletion/mutation analysis: Engineer deletions or mutations in either YidC or its interaction partner to disrupt their association. For example, deletion of YibN's transmembrane segment (residues 1-29) prevented complex formation with YidC in blue-native PAGE analysis .

  • Substrate specificity profiling: Test multiple substrate proteins to determine if interactions affect all YidC substrates equally or show specificity. Research demonstrated that YibN enhanced insertion of YidC-dependent substrates but not YajC or YhcB, which are YidC-independent .

  • Physiological consequence assessment: Examine cellular phenotypes when interactions are disrupted. YibN overexpression led to inner membrane proliferation, creating circumvolutions and multilayered structures .

What are the most effective in vitro systems for studying YidC-mediated membrane protein insertion?

The following in vitro systems have proven valuable for studying YidC function:

  • Inverted membrane vesicles (INVs): Prepared from bacterial cells expressing recombinant YidC or its interaction partners, INVs provide a native-like membrane environment for insertion studies. Researchers can quantify insertion efficiency by measuring membrane-protected fragments after proteinase K digestion .

  • Reconstituted proteoliposomes: Purified YidC can be reconstituted into artificial liposomes with defined lipid composition, allowing researchers to study the minimal requirements for insertion and the impact of specific lipids.

  • Cell-free translation systems coupled with INVs: These systems allow synchronized translation and insertion, making it possible to track insertion kinetics and capture intermediates. This approach revealed that INVs enriched for YibN supported 1.5-1.8-fold stimulation of substrate insertion compared to control membranes .

  • Blue-native PAGE for complex formation: This technique enabled visualization of the YidC-YibN complex and demonstrated the requirement of YibN's transmembrane segment for interaction .

SubstrateIn vitro Stimulation with YibN-enriched INVs
M13 procoat/Pf3 coat1.5-1.8 fold increase
F1-F0 subunit F0c1.5-1.8 fold increase
SecGEnhanced insertion of all topology forms
SecG I20E (mutant)Minimal stimulation

How do researchers determine which membrane proteins require YidC for insertion?

Determining YidC dependence for membrane protein insertion involves several complementary approaches:

  • YidC depletion studies: Construct strains with conditional YidC expression and monitor the insertion efficiency of various membrane proteins under depletion conditions.

  • In vitro insertion assays: Compare insertion efficiency using INVs prepared from wild-type cells versus YidC-depleted cells or cells expressing YidC mutants.

  • Site-directed mutagenesis of substrate proteins: Modify features of membrane proteins that might determine YidC dependence, such as transmembrane segment hydrophobicity. For example, the SecG I20E mutation in its first transmembrane segment reduced the stimulatory effect of YibN on insertion .

  • Crosslinking analysis: Identify direct contacts between YidC and substrate proteins during the insertion process.

  • Comparative analysis across substrate proteins: Research has identified patterns in YidC dependence, showing that proteins like M13 procoat, Pf3 coat, and F0c are YidC-dependent, while YajC and YhcB are not affected by YidC depletion .

The hydrophobicity of transmembrane segments appears to be a critical determinant of YidC dependence, with more hydrophobic segments showing stronger YidC effects .

What imaging technologies provide the most valuable insights into YidC-mediated membrane insertion processes?

Several imaging approaches offer complementary insights into YidC function:

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural information of YidC in complex with ribosomes and substrates. This revealed how YidC interacts with the ribosome at the tunnel exit and identified the insertion site at the YidC protein-lipid interface .

  • Transmission electron microscopy (TEM): Visualizes membrane morphology changes associated with alterations in YidC function. TEM imaging demonstrated that YibN overproduction leads to membrane proliferation with circumvolutions and multilayered structures primarily at the inner membrane .

  • Fluorescence microscopy with tagged proteins: Allows visualization of YidC localization and dynamics in living cells.

  • Atomic force microscopy: Can provide topographical information about membrane proteins in native-like environments.

  • Super-resolution microscopy: Overcomes the diffraction limit to provide nanoscale information about protein organization within membranes.

The choice of imaging technique depends on whether structural details, membrane morphology, or dynamic processes are being investigated.

How should researchers interpret the functional significance of YibN-YidC interactions in membrane protein biogenesis?

The discovery of YibN as a major YidC interactor significantly impacts our understanding of membrane protein biogenesis. When interpreting data on this interaction, researchers should consider:

  • Quantitative enhancement effects: YibN increased the biogenesis of YidC substrates both in vivo and in vitro by approximately 1.5-1.8-fold . This represents a significant but not absolute dependence, suggesting YibN serves as a modulator rather than an essential component.

  • Substrate specificity patterns: YibN enhances insertion of YidC-dependent substrates (M13 procoat, Pf3 coat, F0c) and SecG, but not YidC-independent proteins (YajC, YhcB) . This pattern suggests YibN functions specifically within the YidC pathway.

  • Structural requirements for interaction: The transmembrane segment of YibN (residues 1-29) is essential for YidC interaction , indicating a membrane-embedded interaction interface rather than peripheral association.

  • Membrane effects beyond insertion: YibN overexpression leads to dramatic membrane proliferation , suggesting roles in membrane homeostasis beyond direct insertion assistance.

  • Evolutionary context: While initial studies focused on E. coli, examining whether similar interactions exist in diverse bacteria, including Nitrosomonas eutropha, would provide evolutionary context.

The YibN-YidC interaction reveals that bacterial membrane protein insertion is more complex than previously thought, involving accessory factors that modulate efficiency in a substrate-specific manner.

What factors contribute to contradictory results in YidC research and how can these be reconciled?

When encountering contradictory results in YidC research, consider these potential sources of variation:

To reconcile contradictions, researchers should:

  • Directly compare multiple substrates using identical experimental conditions

  • Validate findings using complementary approaches (in vivo and in vitro)

  • Consider native expression levels when interpreting results

  • Explicitly account for species-specific differences when making comparisons

What are the most promising approaches for translating YidC research into potential antimicrobial strategies?

YidC's essential role in bacterial membrane protein biogenesis makes it a potential target for novel antimicrobials. Promising research directions include:

  • Structure-based inhibitor design: Using the structural model of YidC to design small molecules that disrupt its function or interaction with the ribosome.

  • Targeting YidC-YibN interaction: Developing compounds that prevent the stimulatory effect of YibN on YidC-mediated insertion could reduce efficiency of membrane protein biogenesis.

  • Species-selective targeting: Identifying differences in YidC across bacterial species could enable development of narrow-spectrum antibiotics targeting specific pathogens while sparing beneficial bacteria.

  • Protein-protein interaction inhibitors: Screening for molecules that disrupt the interaction of YidC with substrate proteins at the insertion site identified at the YidC protein-lipid interface .

  • Combination approaches: Developing agents that sensitize bacteria to existing antibiotics by partially compromising YidC function.

The development of YidC-targeting antimicrobials would represent a new class of antibiotics with mechanisms distinct from currently used drugs, potentially addressing antimicrobial resistance challenges.

How might research on recombinant Nitrosomonas eutropha YidC contribute to environmental biotechnology applications?

Nitrosomonas eutropha is an ammonia-oxidizing bacterium that plays important ecological roles in nitrogen cycling . Research on its YidC system could contribute to biotechnology applications through:

  • Enhanced bioremediation systems: Optimizing expression of membrane proteins involved in ammonia oxidation could improve Nitrosomonas eutropha's capacity for nitrogen removal in wastewater treatment.

  • Biosensor development: Engineering recombinant membrane proteins for ammonia detection could create sensitive biosensors for environmental monitoring.

  • Protein expression platforms: Developing Nitrosomonas eutropha as an expression system for recombinant membrane proteins adapted to function in ammonia-rich environments.

  • Synthetic biology applications: Creating hybrid systems combining YidC from Nitrosomonas eutropha with other bacterial components could yield novel functions for environmental applications.

  • Comparative studies with industrially relevant bacteria: Insights from Nitrosomonas eutropha YidC could inform membrane protein expression strategies in other bacteria used in industrial biotechnology.

Understanding the specific adaptations of YidC in ammonia-oxidizing bacteria could reveal principles for engineering membrane proteins to function in extreme or specialized environments.

What technological advances would most significantly enhance our ability to study YidC structure-function relationships?

Several technological developments would substantially advance YidC research:

  • Higher-resolution cryo-EM of insertion intermediates: Capturing YidC-ribosome-substrate complexes at various stages of insertion would provide dynamic insights into the mechanism.

  • Time-resolved structural methods: Techniques that capture structural changes during the insertion process would reveal the conformational dynamics of YidC.

  • Advanced membrane mimetics: Development of improved membrane models that better recapitulate the native environment while maintaining compatibility with structural studies.

  • Single-molecule techniques: Methods to observe individual insertion events would reveal heterogeneity and rare intermediates not detectable in bulk measurements.

  • Improved computational prediction: Enhanced algorithms for predicting membrane protein structures and YidC-substrate interactions would accelerate hypothesis generation.

  • In situ structural methods: Techniques like cryo-electron tomography that can visualize YidC within intact cells would provide contextual information about its native environment.

  • Genetic code expansion technologies: Incorporating non-natural amino acids at specific positions in YidC could enable precise control over its function and detailed mapping of interaction sites.

These technological advances would bridge current knowledge gaps regarding the precise mechanism of YidC-mediated membrane protein insertion and its regulation in different bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.