Recombinant Nitrosomonas eutropha Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Nitrosomonas eutropha monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a glycosyltransferase enzyme critical for bacterial cell wall biosynthesis. Expressed in Escherichia coli, it is a full-length protein (1-244 amino acids) fused with an N-terminal His-tag for purification . The enzyme belongs to the glycosyltransferase 51 (GT51) family and is annotated under UniProt ID Q0AIQ0 . Synonyms include biosynthetic peptidoglycan transglycosylase, monofunctional TGase, and PGT .

Biochemical Properties

PropertyValue/Description
Molecular Weight~27 kDa (calculated from 244 amino acids)
LocalizationMembrane-bound periplasmic enzyme with an uncleaved signal anchor
FunctionCatalyzes glycan chain elongation during peptidoglycan synthesis
ActivityMonofunctional (transglycosylase only); lacks transpeptidase activity
InteractionsInteracts with divisome proteins (e.g., PBP3, FtsW, FtsN) in E. coli

The enzyme’s monofunctional nature distinguishes it from bifunctional penicillin-binding proteins (PBPs) that exhibit both transglycosylase and transpeptidase activities .

Production and Purification

ParameterDetails
Expression HostE. coli
Purity>90% (SDS-PAGE-confirmed)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) added for long-term storage

Handling Notes:

  • Avoid repeated freeze-thaw cycles.

  • Store at -20°C/-80°C upon receipt .

Key Insights

  1. Cell Wall Dynamics: mtgA’s glycosyltransferase activity is critical during cell division, as observed in E. coli, where it compensates for PBP1a/PBP1b deficiencies .

  2. Stress Adaptation: In ammonia-oxidizing bacteria (e.g., Nitrosomonas europaea), peptidoglycan synthesis enzymes are upregulated under nitrogen oxide stress, though mtgA-specific responses remain uncharacterized .

  3. Diagnostic Utility: An ELISA kit targeting mtgA is available for detecting its presence in biochemical assays .

Potential Applications

  • Bioengineering: Engineering mtgA to modulate peptidoglycan structure for novel antimicrobial targets.

  • Proteomics: Studying mtgA interactions in N. eutropha to elucidate stress response mechanisms .

Comparative Analysis with Other Glycosyltransferases

EnzymeFamilyFunctionKey Differences
mtgAGT51Glycan chain elongationMonofunctional; no transpeptidase activity
PBP1a/PBP1b (E. coli)GT51Bifunctional (TGase + TPase)Includes transpeptidase domain; penicillin-sensitive
MltG (Bacillus)GT51Lytic transglycosylaseCleaves peptidoglycan for remodeling

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mtgA; Neut_0495; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Nitrosomonas eutropha (strain C91)
Target Names
mtgA
Target Protein Sequence
MKLTKTSRPTTPQPGLISTWLLRPLLLLLAIALLYQSWFLLHIIYWRTYHPTTSAFMQDR LETMHRQNPAAKLQHRWVDYEQISNHLKRAVIATEDARFMQHQGFDYKAIEVAWKKNLKQ RKLAAGGSTISQQLAKNLFLSSEKTVWRKLQETLITLILEEFLSKRRILEIYLNVIEWGE GVFGIEAAARHYFGIPASSLAPEQSAWLASIISNPRFYDTHRQSPRLLKKARIILSRLPT AKIP
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Nitrosomonas eutropha mtgA and what is its primary function?

Nitrosomonas eutropha monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme that catalyzes glycan chain elongation during bacterial cell wall synthesis. Specifically, it functions in the polymerization of lipid II to form peptidoglycan, a critical component of the bacterial cell wall. The enzyme is classified as a monofunctional transglycosylase (TGase) with the EC number 2.4.2.- . Unlike bifunctional penicillin-binding proteins (PBPs), mtgA exclusively performs the transglycosylase function without transpeptidase activity, making it insensitive to β-lactam antibiotics .

How does N. eutropha mtgA differ from other bacterial transglycosylases?

N. eutropha mtgA differs from other bacterial transglycosylases in several ways:

  • Organism-specific properties: Unlike mtgA from Escherichia coli, N. eutropha mtgA originates from an ammonia-oxidizing bacterium (AOB) that plays a role in nitrogen cycling and possesses unique metabolic capabilities .

  • Sequence variation: While maintaining the core catalytic domain required for transglycosylase activity, N. eutropha mtgA exhibits species-specific sequence variations that may affect substrate specificity and enzyme kinetics.

  • Functional context: The enzyme operates within the distinctive physiological context of N. eutropha, which has adapted to environmental niches where ammonia oxidation is crucial for energy generation .

  • Potential immunomodulatory properties: N. eutropha, the source organism, has been shown to have immunomodulatory effects, potentially suppressing Th2 immune responses through IL-10 dependent mechanisms .

What protein-protein interactions does mtgA form during bacterial cell division?

Research on mtgA protein interactions, primarily based on E. coli studies, reveals a complex network of interactions during bacterial cell division:

Interaction PartnerDetection MethodFunctional Significance
PBP3 (FtsI)Bacterial two-hybrid systemCoordination of peptidoglycan synthesis during cell division
FtsWBacterial two-hybrid systemPotential lipid II flippase collaboration
FtsNBacterial two-hybrid systemRecruitment to division site and activity regulation
Self-interactionBacterial two-hybrid systemPossible dimerization or oligomerization during function

These interactions suggest mtgA functions within a multiprotein complex called the divisome, participating in coordinated peptidoglycan synthesis at the bacterial septum. The transmembrane segment of PBP3 is required for interaction with mtgA, indicating membrane proximity is essential for these functional relationships . Similar interactions may occur with N. eutropha mtgA, although species-specific variations likely exist.

How does the enzymatic activity of mtgA integrate with other cell wall synthesis mechanisms?

The enzymatic activity of mtgA integrates with other cell wall synthesis mechanisms through a coordinated process:

  • Initiation phase: mtgA may contribute to the penicillin-insensitive peptidoglycan synthesis that occurs before constriction during bacterial cell division .

  • Coordination with PBPs: While Class A PBPs (like PBP1a and PBP1b) possess both transglycosylase and transpeptidase activities, mtgA provides dedicated transglycosylase activity that complements the function of these bifunctional enzymes .

  • Division site localization: In E. coli, mtgA localizes at the division site particularly when PBP1b is absent and PBP1a function is compromised, suggesting a compensatory role .

  • Peptidoglycan modifications: Loss of mtgA function has been linked to a 5-10 fold increase in tetra-pentamuropeptide, indicating its activity affects peptidoglycan composition .

  • Functional redundancy: The lack of obvious phenotypic changes in mtgA mutants suggests functional redundancy with other cell wall synthesis enzymes, which must be considered when designing experiments targeting this protein .

What functional role might mtgA play in the unique physiology of Nitrosomonas eutropha?

In the distinctive physiology of Nitrosomonas eutropha, mtgA likely plays specialized roles beyond basic cell wall synthesis:

  • Adaptation to environmental stress: As a soil chemolithoautotrophic bacterium, N. eutropha faces variable environmental conditions. mtgA may contribute to cell wall adaptations that maintain cellular integrity under oxidative stress generated during ammonia oxidation .

  • Connection to nitrogen metabolism: N. eutropha derives energy from ammonia oxidation, which generates nitric oxide as a byproduct . This metabolic pathway may influence peptidoglycan synthesis rates and cell wall composition, with mtgA activity potentially regulated by nitrogen availability.

  • Contribution to immunomodulatory effects: N. eutropha has demonstrated ability to suppress Th2 immune responses . While not directly implicated, cell wall components synthesized through mtgA activity may contribute to the bacterium's immunomodulatory properties through interaction with host pattern recognition receptors.

  • Biofilm formation: AOB like N. eutropha often exist in biofilm communities, and the peptidoglycan structure, influenced by mtgA activity, could affect intercellular adhesion and biofilm architecture.

What are the optimal conditions for storing and handling recombinant N. eutropha mtgA?

Optimal storage and handling of recombinant N. eutropha mtgA requires specific conditions to maintain enzymatic activity:

Storage ConditionRecommendationPurpose
Long-term storage-20°C or -80°CPrevent protein degradation and maintain structure
Working aliquots4°C for up to one weekFacilitate experimental use while minimizing freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerolStabilize protein structure and prevent aggregation
Freeze-thaw cyclesMinimize; prepare single-use aliquotsPrevent activity loss from repeated temperature fluctuations

When working with the enzyme, researchers should:

  • Thaw frozen aliquots rapidly at room temperature or on ice

  • Keep the enzyme on ice during experimental setup

  • Pre-equilibrate reaction buffers to the appropriate temperature

  • Use appropriate protein handling techniques (avoiding vortexing, pipetting gently)

  • Include protease inhibitors if extended manipulation is required

What methods can be used to assess the transglycosylase activity of mtgA in vitro?

Several methodological approaches can be employed to assess the transglycosylase activity of mtgA in vitro:

  • Radiolabeled lipid II incorporation assay:

    • Utilize GlcNAc-labeled lipid II substrate (approximately 9,000-10,000 dpm/nmol)

    • Conduct reactions in optimized conditions (e.g., 15% dimethyl sulfoxide, 10% octanol, 50 mM HEPES pH 7.0, 0.5% decyl-polyethylene glycol, 10 mM CaCl₂)

    • Separate products using thin-layer chromatography or gel filtration

    • Quantify incorporation of labeled substrate into polymerized peptidoglycan

  • Lysozyme susceptibility assay:

    • Perform transglycosylase reaction with purified mtgA and lipid II substrate

    • Treat reaction products with lysozyme

    • Monitor digestion by size-exclusion chromatography or mass spectrometry

    • Complete digestion confirms polymerized peptidoglycan formation

  • Fluorescent lipid II analogs:

    • Synthesize lipid II with fluorescent tags (e.g., dansyl, NBD)

    • Monitor decrease in fluorescence or changes in fluorescence properties during polymerization

    • Calculate reaction kinetics based on fluorescence changes

  • HPLC/mass spectrometry analysis:

    • Analyze reaction products to determine glycan chain length distribution

    • Identify specific peptidoglycan structures formed

    • Compare with known standards to assess enzyme specificity

How can researchers effectively express and purify recombinant N. eutropha mtgA?

A detailed protocol for effective expression and purification of recombinant N. eutropha mtgA involves:

  • Expression system selection:

    • E. coli expression systems (BL21(DE3) or C41(DE3)) are recommended for membrane proteins

    • Consider using pET vectors with T7 promoter for controlled expression

    • Incorporate appropriate tags (His₆, GST, or MBP) to facilitate purification

  • Expression optimization:

    • Test multiple induction conditions (IPTG concentration: 0.1-1.0 mM)

    • Evaluate expression at lower temperatures (16-25°C) to enhance proper folding

    • Extend expression time (16-24 hours) for membrane-associated proteins

    • Consider inclusion of detergents in lysis buffer for membrane proteins

  • Purification strategy:

    • Lyse cells using appropriate buffer (e.g., 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol)

    • Include protease inhibitors to prevent degradation

    • For membrane-associated proteins, solubilize with mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

    • Perform affinity chromatography based on the incorporated tag

    • Apply size exclusion chromatography as a polishing step

    • Verify purity using SDS-PAGE and activity using transglycosylase assays

  • Quality control:

    • Assess protein homogeneity by dynamic light scattering

    • Verify structural integrity by circular dichroism

    • Confirm enzyme activity using in vitro transglycosylase assays

    • Determine protein concentration using Bradford or BCA assays

How can researchers differentiate between mtgA-specific effects and those of other cell wall synthesis enzymes?

Differentiating mtgA-specific effects from those of other cell wall synthesis enzymes requires strategic experimental design:

  • Genetic approaches:

    • Create single and combinatorial knockout mutants (mtgA, PBP1b, PBP1c, etc.)

    • Develop conditional expression systems for essential genes

    • Analyze synteny and complementation between different glycosyltransferases

    • Use CRISPR-Cas9 for precise genetic manipulation

  • Biochemical inhibition strategies:

    • Apply specific inhibitors for different cell wall synthesis pathways

    • Use moenomycin to inhibit transglycosylases while sparing transpeptidases

    • Employ β-lactams to inhibit transpeptidases while preserving transglycosylase activity

    • Design time-course experiments with sequential inhibitor addition

  • Structural analysis:

    • Compare peptidoglycan composition using HPLC or mass spectrometry

    • Analyze glycan chain length distribution in various mutants

    • Quantify specific muropeptide species that may indicate mtgA activity

    • Monitor changes in cross-linking patterns and glycan architecture

  • Localization studies:

    • Use fluorescent protein fusions to track mtgA localization during cell cycle

    • Apply super-resolution microscopy to differentiate spatial organization of different enzymes

    • Perform immunolocalization with enzyme-specific antibodies

    • Compare localization patterns under various growth conditions or genetic backgrounds

What approaches can resolve contradictory data regarding mtgA function in different bacterial species?

Resolving contradictory data regarding mtgA function across bacterial species requires multifaceted approaches:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees of mtgA orthologs

    • Correlate functional differences with evolutionary distances

    • Identify conserved domains versus species-specific regions

    • Map mutations/variations onto structural models

  • Domain swapping experiments:

    • Exchange domains between mtgA proteins from different species

    • Create chimeric proteins to identify functional determinants

    • Test activity of hybrid enzymes in heterologous expression systems

    • Map species-specific functions to particular protein regions

  • Standardized assay conditions:

    • Develop uniform protocols applicable across species

    • Test multiple buffer conditions, pH ranges, and salt concentrations

    • Standardize substrate preparation and quality control

    • Report comprehensive methodological details to facilitate reproducibility

  • Contextual analysis:

    • Consider the cellular environment of each species

    • Examine interactions with species-specific partner proteins

    • Evaluate the role of membrane composition on enzyme function

    • Assess metabolic context and growth conditions

  • Meta-analysis approaches:

    • Apply standardized statistical methods to compare datasets

    • Develop mathematical models incorporating species-specific parameters

    • Use Bayesian approaches to integrate diverse experimental evidence

    • Establish confidence metrics for contradictory observations

How can peptidoglycan analysis be used to study mtgA function in native versus heterologous expression systems?

Peptidoglycan analysis offers powerful insights into mtgA function across expression systems:

Analytical MethodApplication in Native SystemApplication in Heterologous SystemComparative Value
HPLC muropeptide profilingBaseline natural peptidoglycan compositionAltered profiles due to introduced mtgADirect assessment of enzymatic impact
Mass spectrometryDetailed native glycan structureChanges induced by heterologous mtgAIdentification of specific modifications
AFM/electron microscopyNatural cell wall architectureStructural alterations from foreign mtgAVisualization of morphological effects
Glycan chain length analysisSpecies-specific chain length distributionShifts due to heterologous expressionEnzyme processivity assessment

When conducting these analyses, researchers should:

  • Isolate peptidoglycan using standardized protocols:

    • SDS-boiling method for complete cell wall extraction

    • Enzymatic digestion with mutanolysin/lysozyme

    • HPLC separation of soluble muropeptides

    • Mass spectrometric identification of specific structures

  • Compare specific peptidoglycan parameters:

    • Glycan chain length distribution

    • Cross-linking index

    • Proportion of various muropeptide species

    • Modifications (O-acetylation, N-deacetylation)

  • Apply quantitative approaches:

    • Develop statistical methods to compare datasets

    • Use multivariate analysis to identify patterns

    • Apply machine learning for complex pattern recognition

    • Establish quantitative metrics for degree of alteration

  • Control for expression levels:

    • Normalize results to enzyme expression levels

    • Use inducible promoters for titrated expression

    • Employ quantitative proteomics to assess enzyme abundance

    • Consider competitive effects with native enzymes

What potential applications exist for recombinant N. eutropha mtgA in immunology research?

The potential applications of recombinant N. eutropha mtgA in immunology research are informed by emerging understanding of bacterial immunomodulatory properties:

  • Atopic disease modulation:

    • N. eutropha has demonstrated ability to suppress Th2 immune polarization

    • Recombinant mtgA could be used to investigate whether peptidoglycan fragments contribute to this effect

    • Research could explore how bacterial cell wall components interact with the immune system

    • Studies might identify novel immunomodulatory mechanisms for therapeutic development

  • Pattern recognition receptor interactions:

    • Investigating how peptidoglycan synthesized by mtgA interacts with NOD1, NOD2, and other PRRs

    • Comparing immunostimulatory properties of peptidoglycan from different species

    • Exploring how variations in glycan chain length affect immune recognition

    • Developing synthetic peptidoglycan derivatives with tailored immunomodulatory properties

  • Microbiome-immune system interactions:

    • N. eutropha has been detected in human microbiomes but may be depleted in modern lifestyles

    • Research could explore how reintroduction affects immune balance

    • Studies might investigate how mtgA-dependent cell wall structures influence microbiome establishment

    • Analysis of peptidoglycan turnover and immune sampling in various body sites

  • IL-10 pathway investigations:

    • N. eutropha suppresses Th2 responses through IL-10-dependent mechanisms

    • Research could determine if mtgA-derived products contribute to this pathway

    • Studies might explore dendritic cell modulation by specific peptidoglycan structures

    • Investigations could identify therapeutic targets for inflammatory conditions

How might structural biology approaches advance our understanding of mtgA function?

Structural biology approaches offer transformative opportunities for understanding mtgA function:

  • High-resolution structure determination:

    • X-ray crystallography of soluble domains or full-length protein with detergents/nanodiscs

    • Cryo-electron microscopy to visualize membrane-associated conformations

    • NMR spectroscopy for dynamic regions and substrate interactions

    • Integrative structural biology combining multiple techniques

  • Structural comparisons and modeling:

    • Homology modeling based on related glycosyltransferases

    • Molecular dynamics simulations of membrane association

    • Substrate docking and processive elongation modeling

    • Comparison with bifunctional PBPs to understand evolutionary relationships

  • Structure-function relationships:

    • Site-directed mutagenesis of key catalytic residues

    • Domain swapping between species to identify functional determinants

    • Conformational analysis during catalytic cycle

    • Protein-protein interaction interface mapping

  • Visualization of multiprotein complexes:

    • Cryo-electron tomography of divisome structures

    • Super-resolution microscopy of fluorescently tagged components

    • Crosslinking mass spectrometry to identify interaction interfaces

    • In situ structural analysis of mtgA operating within the divisome

What are the implications of mtgA research for developing novel antimicrobial strategies?

Research on mtgA has significant implications for novel antimicrobial development:

  • Target validation considerations:

    • Monofunctional transglycosylases are insensitive to β-lactams

    • mtgA may contribute to antibiotic tolerance through compensatory mechanisms

    • Inhibiting multiple peptidoglycan synthesis enzymes simultaneously may prevent resistance

    • Species-specific variations in mtgA may enable targeted antimicrobial development

  • Potential inhibitor development approaches:

    • Design of moenomycin derivatives specific for monofunctional transglycosylases

    • High-throughput screening for novel chemical scaffolds

    • Peptidoglycan mimetics that compete for active site binding

    • Allosteric inhibitors that prevent protein-protein interactions

  • Combination therapy strategies:

    • Targeting both transpeptidases and transglycosylases simultaneously

    • Disrupting divisome assembly to prevent localization of mtgA

    • Combining cell wall synthesis inhibitors with membrane-targeting agents

    • Developing adjuvants that sensitize bacteria to existing antibiotics

  • Narrow-spectrum considerations:

    • Exploiting species-specific features of mtgA for targeted therapy

    • Developing inhibitors that affect pathogens while sparing beneficial bacteria

    • Utilizing structural differences between human and bacterial glycosyltransferases

    • Creating delivery systems that target specific bacterial populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.