Recombinant Nitrosomonas eutropha NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Nitrosomonas eutropha NADH-quinone oxidoreductase subunit K (NuoK) is a genetically engineered protein belonging to Complex I (NADH:ubiquinone oxidoreductase), a critical enzyme in bacterial respiratory chains. This subunit is encoded by the nuoK gene (UniProt ID: Q0AHJ0) and plays a role in proton translocation across membranes during electron transfer . The recombinant form is typically expressed in Escherichia coli with an N-terminal His tag for purification .

Primary Structure

  • Amino Acid Sequence:
    MVSLSHYLVLGAVLFAIGVVGIFLNRKNVIILLMSIELMLLAVNINFVAFSYYLQDIAGQ IFVFFILTVAAAEAAIGLAILVALFRNIRTINVDDLDRLKG (1–101 residues) .

  • Molecular Features:

    • Transmembrane domains critical for integration into the bacterial membrane .

    • Conserved residues (e.g., Glu-36, Glu-72, cytosolic arginines) essential for proton coupling .

Physical Properties

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C
ReconstitutionTris/PBS buffer with 6% trehalose, pH 8.0

Functional Role in Complex I

NuoK is a core subunit of bacterial Complex I, which catalyzes:

  1. Electron Transfer: NADH → ubiquinone.

  2. Proton Translocation: Generates a proton gradient for ATP synthesis .

Key Functional Insights:

  • Glu-36 and Glu-72: Mutations abolish proton-pumping activity, confirming their role in coupling electron transfer to proton translocation .

  • Arginine Residues: Cytosolic arginines (e.g., Arg-55/56) are critical for structural stability and interaction with adjacent subunits .

Mutational Analysis

  • E36A/E72A Mutants: Loss of coupled NADH oxidase activity (>90% reduction) .

  • R55A/R56A Mutants: Impaired ubiquinone reduction and proton pumping .

Ecophysiological Relevance

  • Nitrosomonas eutropha relies on NuoK-containing Complex I for energy conservation during ammonia oxidation, particularly under nitrogen oxide (NOx)-rich conditions .

  • Proteomic studies show upregulated Complex I subunits under NO₂ stress, suggesting a role in metabolic resilience .

Applications and Future Directions

  • Biochemical Studies: Structure-function analysis of conserved residues .

  • Biotechnology: Engineering bacterial strains for enhanced nitrogen metabolism .

  • Medical Research: Investigating mitochondrial Complex I deficiencies using bacterial homologs .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
nuoK; Neut_0932; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nitrosomonas eutropha (strain C91)
Target Names
nuoK
Target Protein Sequence
MVSLSHYLVLGAVLFAIGVVGIFLNRKNVIILLMSIELMLLAVNINFVAFSYYLQDIAGQ IFVFFILTVAAAEAAIGLAILVALFRNIRTINVDDLDRLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, the immediate electron acceptor is believed to be ubiquinone. The enzyme couples this redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrosomonas eutropha and why is it significant for nuoK studies?

Nitrosomonas eutropha is a motile, gram-negative bacillus that metabolizes ammonia as its energy source. This chemolithoautotrophic bacterium plays important roles in nitrogen cycling and has been studied for its potential benefits in human microbiome contexts . Its significance for nuoK studies stems from its unique metabolic properties and energy conservation mechanisms. As an ammonia-oxidizing bacterium, Nitrosomonas eutropha employs specialized respiratory chain components, including NADH-quinone oxidoreductase (complex I), where the nuoK subunit serves as a critical component in energy transduction processes. The bacterium's ability to thrive in ammonia-rich environments makes it an excellent model system for understanding how respiratory complexes adapt to specialized metabolic niches.

What expression systems are most effective for recombinant nuoK production?

For successful expression of recombinant nuoK from Nitrosomonas eutropha, bacterial expression systems with controlled promoters have proven most effective. Based on analogous studies with similar membrane proteins, expression systems utilizing regulated promoters like the P(BAD) promoter (as used successfully for V. cholerae NADH:quinone oxidoreductase) provide tight control over expression levels, which is critical for membrane proteins that can be toxic when overexpressed . Host strains engineered to lack the genomic copy of the nuo operon prevent interference from endogenous proteins and facilitate purification of the recombinant version. For optimal results, expression protocols should include:

  • Temperature optimization (typically 25-30°C for membrane proteins)

  • Induction at appropriate cell density (mid-log phase)

  • Addition of membrane-stabilizing compounds during growth

  • Use of E. coli C43(DE3) or C41(DE3) strains specifically designed for membrane protein expression

The inclusion of affinity tags (such as hexahistidine) at the C-terminus enables efficient purification while minimizing interference with membrane insertion and function, as demonstrated successfully with similar subunits in V. cholerae Na+-NQR .

What mutagenesis strategies provide the most insight into nuoK function?

Site-directed mutagenesis represents the gold standard for investigating nuoK function, with homologous recombination techniques proving particularly effective for studying this membrane protein. Based on studies with E. coli nuoK homologs, targeted mutation strategies should focus on:

  • Highly conserved glutamic acid residues within transmembrane domains, particularly those analogous to Glu-36 and Glu-72 in E. coli, which have been shown to be critical for coupling electron transfer to proton pumping

  • Conserved arginine residues on cytosolic loops, especially pairs of arginine residues that may function cooperatively (simultaneous mutation of vicinal arginine residues on cytosolic loops leads to severe impairment of activity)

  • Residues predicted to line proton translocation channels based on structural models

  • Conservative substitutions (e.g., glutamic acid to glutamine or aspartic acid) to distinguish between roles in proton coordination versus structural integrity

Each mutation should be evaluated through multiple functional assays including electron transfer activity measurements, proton pumping assays, and assessment of complex assembly state by techniques such as blue-native gel electrophoresis and immunostaining .

How can recombinant nuoK be purified while maintaining activity?

Purification of recombinant nuoK while preserving its native conformation and activity requires specialized approaches for membrane proteins. Based on successful purification of similar subunits, the following protocol is recommended:

  • Membrane isolation by differential centrifugation following cell disruption

  • Solubilization using mild detergents - dodecyl maltoside (DM) has been shown to be effective for maintaining bound quinones and enzymatic activity in similar proteins

  • Affinity chromatography using nickel-NTA or similar matrices to capture histidine-tagged recombinant protein

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Reconstitution into proteoliposomes for functional studies

Choice of detergent is particularly critical - as demonstrated with V. cholerae Na+-NQR, using dodecyl maltoside (DM) preserves bound ubiquinone and enzymatic activity, whereas LDAO results in negligible quinone content and altered activity profiles . Maintaining physiologically relevant ion concentrations (particularly sodium for Na+-dependent enzymes) throughout purification is essential for preserving native structure and function.

What techniques effectively resolve structural details of membrane-embedded nuoK?

Resolving the structural details of membrane-embedded nuoK requires a combination of complementary approaches:

  • X-ray crystallography of the entire complex or subcomplexes containing nuoK, though challenging due to the hydrophobic nature of membrane proteins

  • Cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structural studies by allowing visualization without crystallization

  • Nuclear magnetic resonance (NMR) spectroscopy for analyzing dynamic aspects and residue-specific interactions

  • Crosslinking studies to identify neighboring subunits and proximity relationships

  • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions and conformational changes

  • Molecular dynamics simulations based on homology models from related bacterial species

For topological mapping, combining techniques such as cysteine scanning mutagenesis with accessibility studies can create detailed models of transmembrane organization. Recent advancements in AlphaFold and similar artificial intelligence approaches can provide initial structural predictions that guide experimental design, particularly valuable for membrane proteins like nuoK where traditional structural determination remains challenging.

How can the proton translocation function of nuoK be quantitatively measured?

Quantitative measurement of proton translocation mediated by nuoK requires sophisticated biophysical approaches applied to reconstituted systems:

  • Reconstitution of purified complex I or subcomplexes containing nuoK into proteoliposomes with controlled orientation

  • Monitoring pH changes using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine

  • Membrane potential measurements using potential-sensitive dyes such as oxonol VI or safranin O

  • Ion flux measurements using isotope-labeled ions (e.g., 22Na+ for sodium-translocating complexes)

  • Electrophysiological techniques such as solid-supported membrane electrophysiology

Data from V. cholerae Na+-NQR studies demonstrate that when properly reconstituted into liposomes, recombinant enzyme generates both ion gradients and electrical potential (ΔΨ) across membranes . For optimal results, measurements should include proper controls with specific inhibitors and ionophores to distinguish specific proton translocation from non-specific leakage. The stimulation of enzyme activity by the transported ion (up to 5-fold stimulation by sodium for Na+-NQR) provides additional verification of functional reconstitution.

What is the significance of conserved acidic residues in nuoK function?

Conserved acidic residues in nuoK, particularly membrane-embedded glutamic acids, play fundamental roles in the proton translocation mechanism of complex I. Studies on E. coli nuoK demonstrate that:

  • Mutation of the nearly perfectly conserved Glu-36 leads to almost complete loss of coupled electron transfer activities and eliminates generation of electrochemical gradient

  • Mutation of another highly conserved residue, Glu-72, results in significant reduction of coupled activities

  • These membrane-embedded acidic residues likely function as proton binding and release sites within the translocation pathway

The critical nature of these residues is highlighted by their evolutionary conservation across diverse bacterial species and their homologs in mitochondrial complex I (ND4L). Mechanistically, these residues appear to function as protonatable groups that participate in a proton relay system coupling conformational changes induced by electron transfer to directional proton movement across the membrane. The strategic positioning of these acidic residues within the membrane bilayer creates an energetically feasible pathway for proton movement against an electrochemical gradient.

What can be learned from proton-pumping versus sodium-pumping NADH:quinone oxidoreductases?

Comparative analysis of proton-pumping NADH:quinone oxidoreductases (like those containing nuoK) and sodium-pumping NADH:quinone oxidoreductases (Na+-NQR) reveals important insights about ion translocation mechanisms:

  • Structural organization: Proton-pumping complex I contains 14+ subunits including nuoK, while Na+-NQR typically comprises six subunits with different arrangements

  • Cofactor composition: Na+-NQR contains unique covalently bound flavins (as seen in NqrB and NqrC subunits of V. cholerae) , while proton-pumping complex I utilizes different electron transfer components

  • Ion specificity determinants: Na+-NQR shows 5-fold stimulation by sodium , whereas proton-pumping relies on acidic residues like those in nuoK

  • Energetic efficiency: Different stoichiometries of ions pumped per electron transferred

The detailed characterization of Na+-NQR from V. cholerae provides valuable methodological approaches applicable to nuoK studies, particularly for expression, purification, and functional reconstitution . Understanding the mechanistic differences between these systems illuminates the evolutionary adaptations of respiratory complexes to different environmental niches and energy conservation requirements.

How do the redox components interact with nuoK to facilitate energy conversion?

The interaction between redox components and nuoK is central to the energy conversion mechanism of complex I. Studies from related systems reveal:

  • Sequential electron transfer: Electrons from NADH flow through flavin and iron-sulfur centers in the hydrophilic domain before reaching quinone reduction sites near the membrane domain

  • Conformational coupling: Redox reactions induce conformational changes that propagate to nuoK and other membrane subunits

  • Quinone interaction: The binding and reduction of ubiquinone triggers conformational changes that affect nuoK function

In V. cholerae Na+-NQR, spectroscopic analysis has identified three n=2 redox centers and one n=1 redox center, attributable to flavins and a 2Fe-2S cluster . These components work together to couple NADH oxidation to ion pumping. The presence of bound ubiquinone significantly affects enzymatic activity, as demonstrated by the differences observed between preparations with different detergents (DM preserves bound ubiquinone while LDAO removes it) . Similar interactions likely occur in systems containing nuoK, where the strategic positioning of the subunit enables it to respond to redox-linked conformational changes and facilitate proton movement.

What are the proposed models for proton translocation through nuoK and associated subunits?

Current models for proton translocation through nuoK and associated membrane subunits fall into several categories:

  • Direct coupling model: Protonatable residues (including the conserved glutamic acids in nuoK) form a continuous pathway through which protons physically move across the membrane

  • Indirect coupling model: Conformational changes driven by redox reactions alter pKa values of key residues, causing sequential protonation/deprotonation events without a continuous proton wire

  • Water-gated model: Water molecules within hydrophilic cavities shuttle protons between relatively distant protonatable groups

  • Electrostatic model: Charged residues create long-range electrostatic effects that drive proton movement without direct proton transfer between residues

The critical role of conserved glutamic acid residues in nuoK (Glu-36 and Glu-72 in E. coli) supports models involving these residues as key protonatable groups within the pathway. Additionally, the functional importance of arginine residues on the cytosolic side suggests they may participate in proton uptake or release at the membrane interface . Structural studies of complete complex I indicate that nuoK and other membrane subunits create a series of discontinuous charged residues that may facilitate proton movement through conformational changes rather than through a continuous proton wire.

How do mutations in nuoK affect the assembly and stability of the complete complex?

Studies of nuoK mutations provide important insights into its role in complex assembly and stability:

What is the impact of lipid composition on recombinant nuoK function?

The function of membrane proteins like nuoK is profoundly influenced by the surrounding lipid environment, though this aspect remains understudied for nuoK specifically. Based on research with similar membrane protein complexes:

  • Lipid composition affects:

    • Lateral pressure within the membrane affecting conformational equilibria

    • Surface charge influencing electrostatic interactions with charged residues

    • Hydrophobic matching between protein transmembrane domains and bilayer thickness

    • Specific binding of certain lipids that may stabilize functional conformations

  • Methodological considerations for studying lipid effects include:

    • Systematic testing of different lipid compositions during reconstitution

    • Use of native membrane lipid extracts versus defined synthetic mixtures

    • Application of lipid nanodiscs to control the immediate lipid environment

    • Targeted mutagenesis of residues predicted to interact with lipid headgroups

For functional studies of recombinant nuoK, reconstitution into liposomes with lipid compositions mimicking the native bacterial membrane would likely provide the most physiologically relevant results. When reconstituting NADH:quinone oxidoreductases into liposomes, the lipid composition significantly affects both the efficiency of reconstitution and the resulting enzymatic activity .

How can protein aggregation be minimized during recombinant nuoK expression?

Aggregation represents a major challenge in recombinant membrane protein expression. For nuoK, implementing these strategies can minimize aggregation:

  • Expression optimization:

    • Reduce expression temperature to 18-25°C

    • Decrease inducer concentration for slower, more controlled expression

    • Use specialized strains (C43/C41) designed for membrane protein expression

    • Consider fusion partners that enhance solubility (though these may interfere with membrane insertion)

  • Buffer optimization:

    • Include glycerol (5-10%) as a stabilizing agent

    • Add specific lipids that promote proper folding

    • Use mild detergents at concentrations slightly above critical micelle concentration

    • Maintain physiologically relevant ion concentrations (particularly important for transporting proteins)

  • Co-expression strategies:

    • Express nuoK together with neighboring subunits to promote proper folding

    • Co-express with chaperones specific for membrane protein folding

  • Process optimization:

    • Harvest cells at optimal time points before inclusion bodies form

    • Implement gentle lysis procedures to prevent aggregation during extraction

When purifying similar membrane proteins like Na+-NQR from V. cholerae, researchers successfully used dodecyl maltoside (DM) to maintain native structure and function, demonstrating the importance of detergent selection .

What are the critical parameters for measuring coupled electron transfer in recombinant nuoK systems?

Accurate measurement of coupled electron transfer in systems containing recombinant nuoK requires careful attention to multiple parameters:

  • Electron transfer activity measurement:

    • NADH oxidation rates using spectrophotometric assays (340 nm)

    • Ubiquinone reduction monitoring at appropriate wavelengths

    • Oxygen consumption rates for systems with significant oxygen reactivity

    • Control experiments with specific inhibitors to distinguish complex I activity

  • Proton translocation coupling:

    • pH indicators to monitor proton movement

    • Membrane potential indicators to assess electrochemical gradient formation

    • Uncouplers to distinguish between coupled and uncoupled activities

  • Critical considerations:

    • Temperature control (activity highly temperature-dependent)

    • Buffer composition (ions, pH, ionic strength)

    • Protein:lipid ratios in reconstituted systems

    • Detergent concentration (residual detergent affects coupling efficiency)

How can researchers distinguish between direct effects of nuoK mutations and indirect effects on complex assembly?

Distinguishing between direct functional effects of nuoK mutations and indirect effects caused by assembly defects requires a systematic approach:

Research on E. coli nuoK demonstrates the value of this approach, as mutations in key functional residues (Glu-36, Glu-72, and arginine pairs) significantly impaired activity while still allowing complete assembly of NDH-1 . This confirms these residues' direct involvement in the coupling mechanism rather than in complex assembly. Similar methodological approaches should be applied when studying Nitrosomonas eutropha nuoK to avoid misattributing functional defects to assembly problems or vice versa.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.