Recombinant Nitrosopumilus maritimus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Nmar_0015; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Nitrosopumilus maritimus (strain SCM1)
Target Names
crcB
Target Protein Sequence
MKGLEFVFLAAGSVLGAFLRYKITESPLIFNTLPLNVLIVNVIGAFILGVFIVLSQQWNL DGRYSLFAAIGFCGSLTTMSSFALDSSNLLENNQYGALAANIIVNVGLSIGALIGGKSLM STIISN
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Nitrosopumilus maritimus and why is its CrcB homolog of interest to researchers?

Nitrosopumilus maritimus is an ammonia-oxidizing archaeon first isolated as strain SCM1, with a fully sequenced 1,645,259-bp genome . It represents a globally distributed archaeal lineage that contributes significantly to marine carbon and nitrogen cycling . The CrcB homolog in N. maritimus would likely function as a fluoride ion channel/transporter, potentially playing a role in ion homeostasis within this organism's unique copper-dependent metabolism. This protein is of particular interest because N. maritimus has evolved distinct systems for ammonia oxidation and electron transport that differ significantly from those found in ammonia-oxidizing bacteria , suggesting its membrane proteins may have unique adaptations to marine environments.

What is known about the general structure and function of CrcB homologs in prokaryotes?

CrcB homologs typically function as fluoride ion channels or transporters in prokaryotic organisms, protecting cells from fluoride toxicity. While specific information about the N. maritimus CrcB homolog is limited in the available literature, we can infer that as a membrane protein, it likely exists within the heavily copper-dependent systems that characterize this organism's unique physiology . The N. maritimus genome reveals an unprecedented enrichment of copper-handling proteins, including multicopper oxidases and thioredoxin-like proteins , suggesting that membrane proteins like CrcB may operate within this specialized biochemical context.

What expression systems have been successful for recombinant N. maritimus membrane proteins?

Based on experience with other N. maritimus proteins, periplasmic expression systems have proven more successful than cytoplasmic vectors for recombinant production. For example, the multicopper oxidase Nmar1131 was initially difficult to express using a cytoplasmic vector, but successful purification was achieved when the gene was cloned into pET26b, a vector containing a periplasmic signal peptide . This approach may be similarly effective for CrcB homolog expression, as it would better reflect the predicted native periplasmic nature of membrane-associated proteins in N. maritimus.

How do the copper-dependent systems in N. maritimus potentially influence CrcB homolog function?

N. maritimus possesses highly copper-dependent systems for ammonia oxidation and electron transport that are distinctly different from those in ammonia-oxidizing bacteria . The genome contains six soluble periplasmic multicopper oxidase proteins and numerous copper-binding proteins with plastocyanin-like domains . The CrcB homolog likely functions within this copper-rich biochemical environment. Research should consider how the protein's function might be influenced by copper availability and redox state, possibly through:

  • Proximity to copper-binding proteins in the membrane

  • Potential regulatory interactions with the eight soluble and nine membrane-anchored copper-binding proteins

  • Possible coordination with the DtxR family of metal regulators and ZIP metal transport family proteins

These interactions may modify the canonical functions of CrcB homologs in ways unique to this archaeon.

What challenges exist in distinguishing the function of the CrcB homolog from other membrane transporters in N. maritimus?

The N. maritimus genome reveals a sophisticated membrane protein architecture adapted to its chemolithoautotrophic lifestyle. Distinguishing the specific function of the CrcB homolog presents several challenges:

  • Functional overlap with other ion transport systems

  • Potential integration with copper-handling machinery

  • Possible roles in osmoregulation related to the archaeon's production of ectoine

  • Interaction with thiol-disulfide oxidoreductases from the thioredoxin family (Nmar_0639, _0655, etc.)

Methodological approaches to address these challenges include:

  • Site-directed mutagenesis of conserved residues

  • Fluoride ion transport assays comparing wild-type and CrcB-knockout strains

  • Structural studies comparing the N. maritimus CrcB with better-characterized homologs

  • Membrane localization studies using fluorescent tags

How might the unique lipid composition of N. maritimus affect recombinant CrcB homolog function in heterologous expression systems?

N. maritimus produces distinctive isoprenoid glycerol dialkyl glycerol tetraethers (GDGTs) that comprise its membrane . These archaeal lipids differ significantly from bacterial and eukaryotic membrane lipids, potentially affecting the folding, stability, and function of membrane proteins like CrcB when expressed in heterologous systems. Research has shown that N. maritimus in the Baltic Sea contains phosphohexose (PH) headgroups instead of the hexose-phosphohexose (HPH) headgroups found in other marine settings , suggesting regional adaptations in membrane composition.

When expressing the recombinant CrcB homolog, researchers should consider:

  • Selection of expression hosts with compatible membrane environments

  • Addition of specific lipids during protein purification to maintain native conformation

  • Reconstitution in liposomes containing archaeal lipids for functional studies

What are the recommended approaches for cloning and expressing the N. maritimus CrcB homolog?

Based on successful expression of other N. maritimus proteins, researchers should consider the following methodological approach:

  • Gene synthesis and optimization: Codon optimization for the selected expression host, with removal of rare codons and potentially problematic secondary structures.

  • Vector selection: Use of periplasmic expression vectors (such as pET26b) that include appropriate signal peptides, as this approach proved successful for the multicopper oxidase Nmar1131 .

  • Expression conditions:

    • Initial screening of multiple E. coli strains (BL21(DE3), C43(DE3), Rosetta, Arctic Express)

    • Low-temperature induction (16-18°C)

    • Supplementation with copper ions if copper binding is suspected

    • Inclusion of osmolytes such as ectoine, which N. maritimus naturally produces

  • Purification strategy:

    • Gentle cell lysis using specialized detergents

    • Immobilized metal affinity chromatography with histidine tags

    • Size exclusion chromatography to ensure homogeneity

What functional assays are appropriate for characterizing the recombinant CrcB homolog?

To assess function of the recombinant CrcB homolog, consider these methodological approaches:

  • Fluoride ion transport assays:

    • Liposome-based fluoride efflux measurements using fluoride-selective electrodes

    • Fluorescent indicator dyes sensitive to fluoride concentrations

    • Isotope labeling studies with 18F

  • Binding assays:

    • Isothermal titration calorimetry to measure binding affinities

    • Surface plasmon resonance studies with immobilized protein

    • Fluorescence anisotropy with fluorescently-labeled ligands

  • Structural studies:

    • X-ray crystallography

    • Cryo-electron microscopy

    • Nuclear magnetic resonance for specific domains

  • Interaction studies:

    • Pull-down assays to identify protein partners

    • Yeast two-hybrid screening

    • Cross-linking studies followed by mass spectrometry

How can researchers address the potential copper dependency of the CrcB homolog function?

Given the copper-rich biochemical environment of N. maritimus , researchers should investigate potential copper-related aspects of CrcB function:

  • Metal content analysis:

    • Inductively coupled plasma mass spectrometry (ICP-MS)

    • Atomic absorption spectroscopy

    • Colorimetric copper detection assays

  • Copper-dependency testing:

    • Activity assays with varying copper concentrations

    • Chelator inhibition studies

    • Site-directed mutagenesis of potential copper-binding residues

  • Redox state evaluation:

    • Activity under different redox conditions

    • Thiol modification assays

    • Interactions with thioredoxin-like proteins found in N. maritimus

How does the N. maritimus CrcB homolog compare to those in other ammonia-oxidizing archaea and bacteria?

When analyzing the evolutionary context of the N. maritimus CrcB homolog, researchers should consider:

  • Genomic context comparison:

    • Examination of synteny with other genes across species

    • Analysis of co-evolution with copper-handling genes

    • Identification of potential horizontal gene transfer events

  • Comparative analysis with related organisms:

    • Comparison with Cenarchaeum symbiosum, which shares 1,267 genes with N. maritimus

    • Analysis of differences from ammonia-oxidizing bacteria like Nitrosococcus oceani and Nitrosomonas europaea

    • Evaluation in context of the 3-hydroxypropionate/4-hydroxybutyrate carbon fixation pathway

Table 1: Genomic Features Comparison Across Ammonia-Oxidizing Organisms

FeatureNitrosopumilus maritimus SCM1Cenarchaeum symbiosumNitrosococcus oceani ATCC 19707Nitrosomonas europaea ATCC 19718
Genome Size (bp)1,645,2592,045,0863,481,6912,812,094
GC Content34.20%57.70%50.30%50.70%
ORF Density (ORF/kb)1.190.9860.8890.876
Avg. ORF Length (bp)7579249641009
Membrane TransportersEnriched in copper-handlingSimilar to N. maritimusDifferent systemsDifferent systems

Source: Adapted from Walker et al.

What insights can laboratory evolution experiments provide about CrcB homolog adaptation?

Laboratory evolution experiments could reveal:

  • Adaptive responses to stress:

    • Evolution under increasing fluoride concentrations

    • Adaptation to copper limitation

    • Response to varying salinity and pH

  • Methodological approaches:

    • Serial passage with increasing selective pressure

    • Deep mutational scanning of the CrcB gene

    • Directed evolution with error-prone PCR

    • CRISPR-based genome editing to introduce specific mutations

  • Analysis methods:

    • Whole genome sequencing of adapted strains

    • Transcriptomic profiling to identify compensatory changes

    • Proteomic analysis focusing on membrane protein complexes

How does CrcB homolog function integrate with the unique carbon and nitrogen metabolism of N. maritimus?

The CrcB homolog likely plays a role within the broader metabolic network of N. maritimus, which uses a 3-hydroxypropionate/4-hydroxybutyrate pathway for carbon fixation rather than the Calvin cycle used by most autotrophs . Researchers should consider:

  • Metabolic context:

    • Integration with the ammonia oxidation pathway that provides energy

    • Potential roles in maintaining ion balance during carbon fixation

    • Interactions with key enzymes such as acetyl-CoA/propionyl-CoA carboxylase (Nmar_0272–0274)

  • Systems biology approaches:

    • Metabolic flux analysis incorporating CrcB function

    • Network modeling of ion transport and energy coupling

    • Integration of transcriptomic and proteomic data across growth conditions

  • Experimental validation:

    • Growth phenotypes of CrcB mutants under varying carbon and nitrogen conditions

    • Isotope labeling studies to track metabolic fluxes

    • Membrane potential measurements in wild-type versus mutant strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.