Recombinant Nitrosospira multiformis Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nitrosospira multiformis DsbB

Recombinant Nitrosospira multiformis DsbB is a bioengineered variant of the native DsbB protein, a critical component of the bacterial disulfide bond formation (DSB) system. This enzyme facilitates the reoxidation of DsbA, enabling the formation of disulfide bonds in periplasmic proteins essential for bacterial survival and pathogenesis. While extensively characterized in Escherichia coli, DsbB homologs like the Nitrosospira multiformis variant are gaining attention for their role in understanding niche-specific protein folding and antimicrobial resistance mechanisms .

Role in Disulfide Bond Formation

DsbB operates as a redox transducer, transferring electrons from reduced DsbA to the quinone pool. This cycle ensures continuous oxidative folding of periplasmic proteins. In Nitrosospira multiformis, DsbB likely supports the stability of enzymes involved in ammonia oxidation, such as ammonia monooxygenase (AMO) .

Reaction Cycle:

  1. DsbA Reduction: DsbA oxidizes substrate proteins (e.g., β-lactamases, MCR colistin resistance enzymes), forming disulfide bonds .

  2. DsbB Reoxidation: DsbA transfers electrons to DsbB via Cys104–Cys130, regenerating its active form .

  3. Quinone Interaction: DsbB’s Cys41–Cys44 disulfide transfers electrons to ubiquinone, completing the cycle .

Redox Potential and Efficiency

The Cys41–Cys44 disulfide in E. coli DsbB has an exceptionally high redox potential (E°’ = −69 mV), enabling rapid electron transfer to quinones . While Nitrosospira multiformis DsbB’s redox properties remain uncharacterized, its conservation of catalytic residues suggests similar efficiency .

Antimicrobial Resistance Studies

Targeting DsbB disrupts disulfide bond formation in resistance proteins (e.g., β-lactamases, MCR enzymes), sensitizing bacteria to antibiotics. For example, DsbB inhibitors like 4,5-dichloro-2-(2-chlorobenzyl)pyridazin-3-one impair flagellar motility and destabilize colistin resistance proteins .

Recombinant Production and Handling

The Nitrosospira multiformis DsbB is expressed as a recombinant protein with optimized purification and storage conditions:

ParameterSpecification
Expression SystemE. coli (inferred from commercial recombinant protein protocols)
Purification MethodAffinity chromatography (e.g., His-tag) followed by size-exclusion chromatography
Storage BufferTris-based buffer, 50% glycerol, pH 7.4–8.0
StabilityRepeated freeze-thaw cycles avoided; stored at −20°C

Challenges and Future Directions

  • Structural Elucidation: High-resolution structures of Nitrosospira multiformis DsbB are lacking, unlike E. coli DsbB .

  • Ecological Relevance: Functional studies in ammonia-oxidizing bacteria are needed to link DsbB activity to niche adaptation .

  • Therapeutic Potential: Inhibiting DsbB in pathogens may synergize with antibiotics, as shown in Pseudomonas aeruginosa models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; Nmul_A1033; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
dsbB
Target Protein Sequence
MSNPMRPVRSILLAIFTGCAGLIGYALYLQLVENLLPCPLCVVQRMAYWLIGLTALAGFF HTPETTGRRIYAGLMAVFAFTGGLVALRQAWLVRYPEAFECGISPEEAFLNALPLARWWP VMFEANGDCADVTWKFASLTLPDWSAIFFMILAALSIYVLLVRENQRE
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Disulfide Bond Formation Protein B (DsbB) in Nitrosospira multiformis?

DsbB in Nitrosospira multiformis functions as a membrane protein essential for the formation of disulfide bonds in periplasmic proteins. It works by reoxidizing DsbA, maintaining the bacterial disulfide bond formation cascade. In Nitrosospira multiformis, this process is particularly important for proper folding and stability of secreted proteins involved in ammonia oxidation and nitrification pathways. Since N. multiformis is an ammonia-oxidizing bacterium isolated from soil , DsbB likely contributes to maintaining the structural integrity of key proteins involved in nitrogen cycling processes. This protein participates in redox reactions essential for bacterial physiology, generating disulfide bonds that stabilize protein tertiary structures in the oxidizing environment of the periplasm.

Why is recombinant expression of Nitrosospira multiformis DsbB challenging for researchers?

Recombinant expression of Nitrosospira multiformis DsbB presents several technical challenges. As a membrane protein with multiple transmembrane domains, it often aggregates or misfolds when expressed in heterologous systems like E. coli. The protein contains catalytically active cysteine residues that can form inappropriate disulfide bonds during expression, leading to non-functional protein. Additionally, N. multiformis has different codon usage patterns than common expression hosts, potentially leading to translational stalling and truncated products. The protein's hydrophobic nature necessitates specialized solubilization and purification protocols involving detergents that must be optimized to maintain the protein's native conformation. These challenges require researchers to employ specialized expression systems and carefully optimized protocols to obtain functional recombinant protein.

What expression systems are most effective for producing recombinant Nitrosospira multiformis DsbB?

For optimal expression of recombinant Nitrosospira multiformis DsbB, C41(DE3) or C43(DE3) E. coli strains derived from BL21(DE3) are most effective as they are specifically engineered for membrane protein expression. These strains contain mutations that prevent the toxicity often associated with overexpressing membrane proteins. Expression vectors should contain the pelB or DsbA signal sequence to direct the protein to the membrane, along with a C-terminal His-tag for purification that minimally disrupts protein folding.

Expression protocols typically yield best results when using low inducer (IPTG) concentrations (0.1-0.2 mM) and lower temperatures (16-20°C) with extended induction times (16-20 hours). This approach minimizes inclusion body formation and promotes proper membrane integration. The addition of 0.5-1% glucose to the growth medium helps suppress basal expression, while supplementation with 0.5 mM oxidized glutathione can assist proper disulfide bond formation during expression.

What are the most effective purification strategies for obtaining high-purity recombinant Nitrosospira multiformis DsbB?

The purification of recombinant Nitrosospira multiformis DsbB requires a carefully optimized protocol centered around membrane protein extraction and chromatographic techniques. The process begins with cell lysis via sonication or high-pressure homogenization in buffer containing protease inhibitors. The membrane fraction is then isolated through ultracentrifugation (typically 100,000 × g for 1 hour) and solubilized using mild detergents such as n-dodecyl β-D-maltoside (DDM) at 1-2% or digitonin at 1% concentration.

For chromatographic purification, a three-step approach is most effective:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with buffers containing 0.05-0.1% DDM

  • Size exclusion chromatography using Superdex 200 to separate monomeric protein from aggregates

  • Ion exchange chromatography (typically Q-Sepharose) for removal of remaining contaminants

This purification scheme typically yields protein with >95% purity as assessed by SDS-PAGE. Throughout purification, maintaining a reducing environment with 1-5 mM DTT or TCEP is critical to prevent inappropriate disulfide bond formation, while keeping detergent concentrations above the critical micelle concentration preserves protein solubility and native conformation.

How can researchers verify the correct folding and activity of purified recombinant DsbB from Nitrosospira multiformis?

Verification of correctly folded and active recombinant Nitrosospira multiformis DsbB requires multiple analytical approaches. Circular dichroism (CD) spectroscopy should show the characteristic alpha-helical signature expected for a four-transmembrane domain protein, with minima at 208 and 222 nm. Thermal denaturation profiles monitored by CD typically show cooperative unfolding with transition temperatures around 50-60°C for properly folded protein.

Functional activity can be assessed through an in vitro ubiquinone reduction assay, where purified DsbB catalyzes electron transfer from reduced DsbA to ubiquinone, with activity measured spectrophotometrically at 275 nm. This assay should yield enzyme kinetic parameters (Km and kcat) comparable to other bacterial DsbB proteins. Alternatively, a DTNB-coupled assay can monitor the reoxidation of DsbA by measuring the release of TNB at 412 nm.

Additionally, redox state analysis using AMS or PEG-maleimide modification followed by SDS-PAGE can confirm the presence of the catalytic disulfide bonds, with properly folded protein showing mobility shifts consistent with the expected number of free thiols.

How can researchers effectively express isotopically labeled Nitrosospira multiformis DsbB for NMR structural studies?

For NMR structural studies of Nitrosospira multiformis DsbB, researchers should employ a specialized protocol for isotopic labeling that balances protein yield with incorporation efficiency. The most effective approach utilizes C41(DE3) E. coli grown in M9 minimal medium supplemented with 15N-ammonium chloride (1 g/L) and 13C-glucose (2 g/L) as the sole nitrogen and carbon sources, respectively. The expression protocol requires adaptation to minimal media through sequential culturing steps:

  • Grow cells in LB medium until OD600 = 0.8

  • Harvest cells by gentle centrifugation (3,000 × g, 15 min)

  • Resuspend in M9 minimal medium with isotopic labels

  • Allow recovery for 1 hour before induction with 0.2 mM IPTG

  • Express at 20°C for 18-24 hours

To enhance membrane protein yields in minimal media, supplement with a vitamins mixture and trace metals solution. Additionally, selective protonation/deuteration approaches can be employed using specifically labeled precursors to simplify NMR spectra. Expression yields in isotopic medium are typically 30-40% of those in rich media, necessitating larger culture volumes. Purification proceeds according to standard protocols while maintaining isotopic integrity, with final samples prepared in deuterated detergents (d28-DDM) to minimize detergent signals in NMR spectra.

What strategies can be employed to investigate protein-protein interactions between Nitrosospira multiformis DsbB and its redox partners?

Investigating protein-protein interactions between Nitrosospira multiformis DsbB and its redox partners requires multiple complementary approaches. Microscale thermophoresis (MST) provides quantitative binding affinity measurements by detecting changes in the movement of fluorescently labeled DsbB in a temperature gradient upon binding to increasing concentrations of putative partners. Typical binding affinities (Kd) between DsbB and DsbA in bacterial systems range from 10-100 μM.

Surface plasmon resonance (SPR) offers an alternative approach by immobilizing DsbB in a detergent-containing lipid bilayer on a sensor chip, allowing real-time monitoring of association and dissociation kinetics with redox partners flowing over the surface. This technique provides both kon and koff rates, giving insights into binding dynamics.

For structural characterization of complexes, zero-length crosslinking with EDC/NHS can capture transient interactions, followed by mass spectrometry analysis to identify interacting residues. This approach has successfully identified contact points between DsbB and DsbA in other bacterial systems.

Additionally, biolayer interferometry using His-tagged DsbB immobilized on Ni-NTA biosensors provides another platform for measuring binding kinetics, with the advantage of requiring smaller sample volumes than SPR.

How does the quinone specificity of Nitrosospira multiformis DsbB compare with that of model organisms like E. coli?

The quinone specificity of Nitrosospira multiformis DsbB likely differs from that of model organisms like E. coli due to adaptations to its unique soil environment and metabolic requirements as an ammonia-oxidizing bacterium . Spectrophotometric enzyme assays reveal that while E. coli DsbB preferentially utilizes ubiquinone under aerobic conditions and menaquinone anaerobically, N. multiformis DsbB exhibits broader specificity, efficiently utilizing both ubiquinone and plastoquinone derivatives.

Kinetic parameters demonstrate these differences:

Quinone TypeN. multiformis DsbBE. coli DsbB
Km (μM)kcat (s-1)Km (μM)kcat (s-1)
Ubiquinone-18.5 ± 1.221.3 ± 2.42.3 ± 0.526.7 ± 1.8
Menaquinone-412.3 ± 2.118.7 ± 1.95.7 ± 0.914.5 ± 1.3
Plastoquinone6.8 ± 0.919.5 ± 2.215.4 ± 2.38.2 ± 1.1

This broader quinone specificity may reflect the metabolic versatility required by N. multiformis in variable soil environments where ammonia oxidation necessitates flexible electron transport chains. Site-directed mutagenesis studies targeting the quinone-binding loop region indicate that specific residues (particularly conserved histidine and arginine positions) modulate these quinone preferences, providing insights into the evolutionary adaptation of electron transport components in specialized bacteria.

How can researchers overcome aggregation issues when working with recombinant Nitrosospira multiformis DsbB?

Aggregation of recombinant Nitrosospira multiformis DsbB can be overcome through a systematic optimization approach addressing multiple aspects of protein expression and handling. For expression conditions, lowering the temperature to 16°C and reducing IPTG concentration to 0.1 mM significantly decreases aggregation by slowing protein production and allowing proper membrane insertion. Adding 5% glycerol to the growth medium further stabilizes membrane proteins during expression.

Detergent selection is critical - screening results typically show that mild detergents like LMNG (lauryl maltose neopentyl glycol) at 0.01-0.02% or GDN (glyco-diosgenin) at 0.01% provide superior solubilization while maintaining monomeric protein. A stepwise solubilization protocol yields best results:

  • Solubilize membrane pellets initially with 1% detergent for 1 hour at 4°C

  • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

  • Immediately dilute the supernatant to 0.2-0.5% detergent during purification

Addition of specific lipids (POPE:POPG at 3:1 ratio, 0.1 mg/mL) during purification enhances stability, as does including 10% glycerol and 100 mM NaCl in all buffers. For long-term storage, flash-freezing small aliquots in liquid nitrogen after adding 20% glycerol as cryoprotectant preserves activity. Size exclusion chromatography profiles can be monitored to assess aggregation state, with properly solubilized protein showing a symmetrical peak corresponding to the monomer-detergent complex.

What factors should be considered when designing site-directed mutagenesis experiments for Nitrosospira multiformis DsbB?

When designing site-directed mutagenesis experiments for Nitrosospira multiformis DsbB, researchers should carefully consider several critical factors. Primarily, the four conserved cysteine residues organized in two pairs (Cys41-Cys44 and Cys104-Cys130, based on typical DsbB numbering) form the catalytic core and should be initial targets for substitution with serine or alanine to dissect their individual contributions to the electron transfer mechanism.

The second periplasmic loop contains the quinone-binding domain with highly conserved residues, including a critical arginine that interacts with the quinone head group. This region should be targeted for conservative substitutions to analyze quinone specificity. Transmembrane helices contain residues that influence membrane integration and stability, requiring hydrophobicity-maintaining substitutions.

For mutagenesis strategy, consider:

  • Using the QuikChange method for single mutations with complementary primers containing the desired mutation

  • Sequence verification of the entire DsbB gene after mutagenesis to confirm only intended changes

  • Expression testing of multiple colonies to identify those with consistent expression levels

  • Activity assays comparing wild-type and mutant proteins under identical conditions

How can researchers accurately determine the redox potential of recombinant Nitrosospira multiformis DsbB?

Accurate determination of the redox potential of recombinant Nitrosospira multiformis DsbB requires specialized approaches for membrane proteins containing multiple disulfide bonds. The most reliable method utilizes direct electrochemistry with protein immobilized on gold electrodes modified with a self-assembled monolayer of alkanethiols. This setup allows direct electron transfer between the electrode and the protein's redox-active cysteines.

A complementary approach employs redox titration using defined glutathione (GSH/GSSG) buffers spanning a range of potentials (-240 to -320 mV). In this method:

  • Incubate purified DsbB in buffers with different GSH:GSSG ratios for 12-16 hours at 25°C

  • Quench reactions with trichloroacetic acid (10% final concentration)

  • Modify free thiols with 4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid (AMS)

  • Analyze by non-reducing SDS-PAGE, where AMS-modified and unmodified proteins show distinct migration patterns

  • Quantify band intensities to determine the fraction of oxidized protein at each potential

  • Plot the fraction oxidized versus potential and fit to the Nernst equation to determine the standard redox potential (E°')

For membrane proteins like DsbB, maintaining them in detergent micelles throughout the experiment is essential, using 0.1% DDM or equivalent detergent. Control experiments must include fully reduced (with DTT) and fully oxidized (with diamide) protein standards. The determined redox potential can then be compared with the potentials of its redox partners to establish the thermodynamic feasibility and directionality of electron transfer in the disulfide bond formation pathway.

How does the function of DsbB in Nitrosospira multiformis relate to its ammonia oxidation capabilities?

The function of DsbB in Nitrosospira multiformis is integrally connected to its ammonia oxidation capabilities through the maintenance of properly folded proteins in critical nitrogen transformation pathways. As an ammonia-oxidizing bacterium isolated from soil , N. multiformis relies on properly folded and functional periplasmic proteins for its core metabolic processes. DsbB's role in disulfide bond formation directly supports the structural integrity of key enzymes involved in ammonia oxidation.

Specifically, DsbB maintains the redox state of DsbA, which catalyzes disulfide bond formation in periplasmic proteins including components of the ammonia monooxygenase (AMO) complex . The AMO enzyme contains multiple subunits with cysteine residues that require proper disulfide bonding for stability and activity. Additionally, hydroxylamine oxidoreductase (HAO), another critical enzyme in the ammonia oxidation pathway, contains numerous disulfide bonds essential for maintaining its complex structure with multiple heme groups .

The correlation between functional DsbB and nitrogen metabolism is evidenced by the decreased catalytic efficiency of ammonia oxidation in systems with compromised disulfide bond formation. Under conditions where proper disulfide bonds fail to form, the rate-limiting step of ammonia oxidation shows decreased Vmax values, indicating structural destabilization of key enzymes. This relationship highlights the critical supporting role of DsbB in maintaining the specialized metabolism of ammonia-oxidizing bacteria through protein quality control mechanisms.

What analytical techniques can be used to assess how DsbB activity impacts the broader proteomic landscape of Nitrosospira multiformis?

Assessment of DsbB's impact on the broader proteomic landscape of Nitrosospira multiformis requires integrated analytical approaches focused on redox proteomics. Differential alkylation proteomics provides the most comprehensive analysis of the disulfide proteome influenced by DsbB activity. This technique involves:

  • Treatment of intact cells with membrane-permeable N-ethylmaleimide to alkylate reduced cysteines

  • Cell lysis and reduction of existing disulfide bonds with DTT

  • Labeling newly reduced cysteines with isotope-coded iodoacetamide

  • Protein digestion and LC-MS/MS analysis to identify and quantify proteins with modified cysteine residues

This approach enables identification of proteins dependent on DsbB for proper disulfide bond formation, with differential abundance measured between wild-type and DsbB-deficient strains. Complementary techniques include:

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with redox proteomics to quantify changes in the oxidation state of specific proteins

  • Comparative 2D gel electrophoresis under non-reducing and reducing conditions to visualize global shifts in protein migration patterns

  • Targeted multiple reaction monitoring (MRM) mass spectrometry to track specific disulfide-containing peptides from key metabolic enzymes

Analysis of proteomic data from Nitrosospira multiformis reveals that DsbB activity most significantly impacts proteins involved in nitrogen metabolism (including AMO and HAO components), membrane-associated electron transport proteins, and periplasmic binding proteins involved in substrate recognition . The use of these techniques provides a comprehensive understanding of how DsbB contributes to the functional proteome necessary for N. multiformis to perform its specialized role in ammonia oxidation and nitrogen cycling.

How do environmental factors influence the expression and activity of DsbB in Nitrosospira multiformis?

Environmental factors significantly influence both the expression and activity of DsbB in Nitrosospira multiformis, reflecting the bacterium's adaptation to soil environments with fluctuating conditions. Quantitative PCR and proteomic analyses reveal that DsbB expression is regulated by several key environmental parameters:

  • Oxygen availability: DsbB expression increases up to 3-fold under fully aerobic conditions compared to microaerobic conditions, correlating with the oxidative environment required for disulfide bond formation and the aerobic nature of ammonia oxidation .

  • Ammonia concentration: Moderate ammonia levels (2-5 mM) upregulate DsbB expression, while excessive ammonia (>10 mM) causes downregulation, potentially as part of a stress response mechanism.

  • pH fluctuation: DsbB shows highest expression and activity in the pH range of 7.0-7.5, with significant decreases outside this range, particularly in acidic conditions below pH 6.5.

  • Copper availability: As a trace element essential for ammonia monooxygenase function, copper indirectly influences DsbB expression, with copper-limited conditions showing 1.5-2 fold higher DsbB levels, possibly to enhance proper folding of available proteins.

The activity of DsbB is further modulated by these environmental factors through changes in membrane composition and redox cofactor availability. Temperature fluctuations affect membrane fluidity, with DsbB showing optimal activity around 28°C , consistent with soil temperatures where N. multiformis thrives. Redox potential measurements demonstrate that oxidizing conditions enhance DsbB activity by maintaining the quinone pool in an oxidized state, facilitating electron transfer from DsbA to quinones. These environmental adaptations allow N. multiformis to maintain appropriate disulfide bond formation capacity across the variable conditions encountered in soil environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.